KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100890679Help
Entry
100890679         CDS       T01019                                 

Definition
voltage-dependent calcium channel subunit alpha-2/delta-3-like
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Ion channels [BR:spu04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100890679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1225 aa AA seqDB search
MDLIRHSCSACLSAFKKINPSSNCPGIFAMLRFGVILWILLITARGTSCEVTIRRNTVVS
WADELGRRLYNLSRTYSGSDVVHEQYSNEQNIEIVPVDGVELVRDMAHQMETMLQDKAKA
VERIVQAAEEGFLNHDYDNATEFTYYNAILINSNATTSPDLEKDIRKDLDVTPDSHFENI
PINTSIAAIQVPTNVYNQGTEVLNSIEATELLDTTYRENYQNDPTLTWQFFGSRTGYFRL
YPGYKWIPPQENLDLYDCRVRGWYVEGATSPKDVVILVDMSGSMTGLYVEIAKYAIKKIL
DTFGDNDFVNVISFNETTKFIQPCFNDTMVQATSDNKNLIKDALTRTVPKLEPYGMADLS
RAVRYAFNLLNDFNSTNRGSECNQAIMIISDMLTETAEDVFKELNPNQTTRVFTYQTGRE
VDGPTNLIKVACDNRGYYTRLATISDVEEHVTSYLHVLSRPMVNKRLRKTVWSSVYWDAL
GLGLTCSVSQPVFNVKNETMDKGILEGVAGCDVPIKELKKFTPPFKLGVNGYSFAVTNNG
YILFHPELRYLHTDGSVKPNYNSVDLSEVELSDTDDVLRNSLVDRDTGGVTMEIKYMFDK
MKRVSIRRSKYYFTFLFETPYSLGISLPEAYASKHLKTPATFDMESSGNYSSADVCEIQQ
AARLLFGDGTVGTTIIANWLYCKINYSSSERYEGEEHVARFLEDAAKRGGKLSPTCDTVM
VNHLIFDANVTRFMPDYWKLVYGEALPSTVDTTMFTTLSTNESDSDAISSIQDILAQIDD
YCSPGGQGYTTATPHNKTEDSEDGEVMTTEDSGTHPTEAPNMRYTTSLFGTTEDVPYVEF
PYLDPIRDGVVLSFLGTYGGLTRIYHNPNMYYPFSDFSNKEEQSTIEEDYFRRPVDEINE
GFIYSVPFDSELEYSFDPLVTASTAIRATKDGSSFVTAAAGYQFLESALQDLFFNITRQH
DEEDCGYDCTPSCFNDSVDCFLIDNHGYIVVSKDQSQVGSHFASHSQNIRLFDKLINDDI
FKEVKVVDYQGMCGRDIIVSAAPTLHNTLSNILSMFTWLANQFTVFLSHISVYDWLVSTL
SPVDALAERVWYEPCDLEYSFYVANKSDNFVGGQLYGYFQTFCDDCIKSFGVQPVPYSNL
LLVIQDRDCTCEPRDSVQLDPIEVEYNETAWCQKLRQFKTRRRPDTCFNYDKKEDSSECG
RGFTTQPSTILILTALVLTAWWRHH
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atggatctaatcagacattcttgttcagcatgtttatcagcttttaagaagattaatccc
tcgtcgaattgccctggtatattcgcgatgcttcgtttcggagttatattatggatatta
ctaattaccgcacggggaacgagctgtgaggtaacgatacggagaaacactgtggtctcg
tgggctgatgaattaggaaggcgattatacaacctaagtagaacatacagtggaagcgat
gttgttcacgagcaatatagcaacgaacagaacattgagatcgtacctgttgatggagtg
gagctggttcgtgatatggctcaccagatggagacaatgttacaggacaaggctaaagct
gtcgagagaatcgttcaggcggccgaggaaggttttctgaatcatgactacgacaatgca
acagagttcacgtactacaatgcaatacttataaattcgaatgctacaacgagcccggat
ttagagaaagatatccggaaagacctggacgttacaccggattcccattttgaaaacatc
ccgatcaacacttctattgcagctattcaagtgccaactaacgtgtacaatcaaggtact
gaagtgctgaatagtattgaagccacggagttgttagacacaacctatcgggaaaactac
caaaacgacccgactctgacctggcaattctttggcagcagaacaggctacttcagattg
tacccgggatataaatggataccgcctcaggagaatctcgatctatacgattgtagagta
cgtggatggtatgttgaaggggcgacatcccctaaagacgtggtgattttggtcgacatg
agcggcagcatgactggactctacgtcgagatagccaaatacgccattaaaaagatcctg
gacacatttggcgataacgatttcgtcaacgtcatcagcttcaacgaaaccaccaagttt
attcagccttgttttaacgataccatggtgcaagctacttcagataacaaaaacttgatt
aaagatgcactcactagaactgtccccaaactggagccgtacggtatggcagacctatca
agagctgtgagatatgcattcaatttattgaacgattttaacagcacaaaccgtggctct
gaatgcaaccaggcaatcatgatcatctccgatatgctcaccgaaacagctgaagatgtc
ttcaaagaactcaacccaaatcaaacgacaagagtgttcacctaccaaacaggacgtgaa
gtagatggacctactaatctcatcaaggtcgcatgtgacaatcgaggttactacactcga
ctagcaacaatctctgatgtcgaagaacatgtgacaagttatcttcatgtgcttagtcga
ccgatggtgaataaacgacttcgtaaaaccgtctggagtagcgtctattgggatgcctta
ggtcttggtttgacatgctctgtatctcaaccagtcttcaacgtcaaaaacgaaacgatg
gataagggaattctcgaaggagtagcaggatgcgatgttcccatcaaggaattgaaaaag
tttaccccgccgtttaagctcggtgtgaatggatactcgttcgcggttacaaataacgga
tacatcctcttccatccggaactgagatatcttcatacagatgggagtgtcaaaccgaat
tacaacagtgtggatctatccgaagttgaattatccgatactgacgatgtgctccgtaat
tcattggttgaccgggatacaggcggcgttaccatggagattaagtacatgtttgataaa
atgaaaagagtcagcattcgtcgtagcaaatattacttcacatttttattcgaaacaccc
tacagcttgggtatctctctccctgaggcatacgccagtaaacatctgaaaactccagct
acgtttgacatggaatcttcaggaaactattcaagtgcagatgtatgcgaaatacaacaa
gctgcaagacttttatttggagacggaacagtggggacaacaattattgccaattggtta
tactgtaagatcaattacagttcttctgagcgatacgagggtgaggagcatgtggctaga
ttccttgaagatgccgccaaaagaggtggcaaactgagccctacttgtgacactgtgatg
gtgaaccacctaatctttgatgctaatgtcactcgctttatgccggattactggaaattg
gtttacggtgaagcgcttccaagcaccgtggacaccaccatgttcaccaccctatcaacc
aacgagtccgattcagatgcaatctccagcatccaggacatcttggcccagatagatgac
tattgttcccctggaggacaggggtacaccacggccacaccccacaataagacagaagat
tctgaggatggagaagtaatgactacagaagatagtggcacgcatcctacagaagcaccc
aacatgcgttacaccacatcgctctttggaacaacggaagatgttccatacgtggaattc
ccatacctcgatccaataagagacggtgtggtcctgtcctttcttggtacatacggtggc
ctaacacggatataccacaacccaaacatgtactatccattttcggatttttccaacaaa
gaggaacaaagcacaatcgaggaggattactttcgaagaccagtagatgaaatcaacgag
ggatttatatattctgtcccgtttgattcggagttagaatacagctttgatcctttggtg
acagcaagcacagcaatacgtgctaccaaggatggttcttcatttgttacagcggctgct
ggctatcaatttttggagagtgccttacaggatttatttttcaacattacacgccaacac
gacgaagaggactgtggctacgactgcaccccgtcatgtttcaatgacagtgtagattgc
ttcctcatcgacaaccatggttacattgtagtttcaaaggaccaatcacaggtgggatca
cattttgcctcgcattcacagaacataagattgttcgacaagcttatcaacgatgacata
ttcaaggaagtaaaagtggttgattatcaaggaatgtgtggccgtgatatcatagtcagt
gctgccccaacgcttcacaatacattatcaaatattctgtcaatgttcacctggttggcc
aatcaattcacagtcttcctaagccatatcagtgtgtacgattggttggtatctacatta
tcgcctgtagatgcattagctgagagagtatggtatgagccctgtgatctcgagtactca
ttttatgttgcgaataaatctgataacttcgtgggaggccaactatacggttacttccaa
actttttgtgacgactgcatcaaatctttcggtgtgcagccagtgccttattctaacctc
cttctagtcatccaggacagagactgtacctgcgagccgagagatagcgttcaactagat
cctatagaggtagaatacaatgaaacagcctggtgccaaaaactacgacaattcaagaca
aggcggagacctgatacgtgcttcaactatgataaaaaagaggattcttcagagtgtggg
cgtggcttcactacccaaccttccaccattctcattctcactgctcttgttttgaccgca
tggtggcgtcaccattaa

DBGET integrated database retrieval system