KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100891017Help
Entry
100891017         CDS       T01019                                 

Definition
protein disulfide-isomerase TMX3-like
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 226 aa AA seqDB search
MEAARLRTCNKQPVLMKYILTVFGVFLLSFDLVQGNVIELDERFIDAKDQGKWLVEFYAP
WCGHCQKLKPVWADVGIQMMKNHPKLHVARLDGTRFGKVMDMFDVKGFPTIKYIEGDKVF
THTGGRTSKDIIDFANKAQGPAVKQLSSSNSLQQYRQSKAVFFVIAAEDTTSELATLFST
VADKRILDAFYYHVKPNVIPEDMRPKNVPAILVFKDGLHYQYEDLQ
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgctaggctgagaacgtgtaacaaacaaccggttttaatgaagtatattcta
acagtttttggagtattcctgttatcctttgacttggtccaaggcaatgtgattgaactg
gatgagaggtttattgacgctaaagaccaggggaagtggcttgttgagttttatgcccct
tggtgcggtcactgtcagaagttgaagccggtatgggcagacgttgggattcagatgatg
aagaatcatccaaaactgcatgtagccagattggatggaacacgtttcggaaaagtgatg
gatatgtttgatgtgaagggctttccaactatcaaatatattgaaggagataaggtcttt
acacacacaggaggaaggacatctaaagatatcattgattttgcaaacaaagcacaagga
cctgcagtaaaacaactctcaagctctaatagtcttcaacagtacagacagagcaaagct
gtattctttgttatagctgctgaagatactactagtgaattagcaacattattctcgact
gtagctgataagcgtattctagatgccttctattaccatgtcaaacctaacgttatacca
gaggatatgagaccaaagaatgttccagccatcctggtttttaaagatggtctccactat
cagtacgaagacctgcagtaa

DBGET integrated database retrieval system