KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100891078Help
Entry
100891078         CDS       T01019                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 19
  KO
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100891078
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100891078
Ubiquitin system [BR:spu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100891078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1202 aa AA seqDB search
MGVKDVGEGKIKYEWRQTDEDIYIDFDVNGKIKKEDVELRLDDSGKTCVCNVCFKDGSKW
VCSLQHLVLKSSAGVKVKDGALIVHLQKKEKFKQWKQLGDCAFTKAKQEKGISNAANEKG
NPKEGTSVVRDGEGDGQKDEIEEYVVNHVKHSFFPRQDLKVIYFHVYVKKIRRDSVNVTF
TENEICIKFKTSDNQFLQMNSGSTSDTLFCWRIRPWRPIDPEGCHHKVTKSNLEINITAQ
KAEKWKALECSTKESGDGSRGRAASQGDWVPLSSSQTATPQRAKESAEITKDAGSEKENL
RGAVGGAKSVEIKENVTRTKKPTCTVPPLSLGKQTPSLPAEPTPSLHYGYCGLDNLGNTC
FMNSVLQVLANTRELKDFMLGADFKNEINRDNPLGSGGHLVLSFAVLMRRLWGGQHKSIA
PSKLKSIISAKASQFMGFAQHDAQEFMAFLLDGLHEDINRIRKKPYTQTIDSDGRHDEDI
NRIRKKPYTQTIDSDGRHDEVSITFDPFMHLSMPLPKKKRHFPVYFFSRDCNQRPVKYVL
SLGSDATVHDLTVQVGQMAGVNAANLRVFEVHRSCIHKVFSRRSTLSGMSFNDIIFVHEV
LSPAMAGESVVELSVIQRMLMPPALLHCSHCKKSCEKGRSLKRCTKCYRVAYCDQACQKS
NWNTHRPTCRRFPEPVGCPFIISLPKSHATYARLCQLMECYARYSTNVFVPPLKPPGTVS
SPGNSSHESEHPSTSTDSQPQSDGVAPSTTTTSPADASRIPTTETTMDDEEMGDGQDGKE
RMEDIGLEDPIQSEEMGDGMMEGTSDKDEALRKGEGGGGGGDSGAESRGNSSDMEGAATA
TVVGQPQTQERKMPLFFVKPVNHIGNSIPSKERLTDKGDVPLDLSGIISVAMDWRNDPKQ
ENNVLVESRTLDYAEDESVCGKSYEETEITLDQCLKLFTEPEKLAPGEAWYCPKCKQHRE
ATKQMLLWRLPSTLIIQLKRFSFGNMLWRDKINKMVEYPVRGLDLSPYCHGSHGTPLIYD
LYGVINHHGGILGGHYTSFGRLASTADWSKNEHDWRLFDDNHVTTVSEKNVVTRSAYLLF
YRRRQPYTPYIWQAPADPEPEEEEPEVEPQREPQQEHKSVQETGDEPEEMDDKSSTCSSE
MEVSERDPSDAAGVERPGKQFPHHDNRFSASSQPPAPLQTSCVDKRSRDGEDIGYTDMED
ID
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaaggatgtcggagaaggtaaaattaaatatgaatggagacagacagatgaa
gatatttacattgattttgatgtgaatgggaagatcaagaaagaggacgttgaactcaga
cttgatgacagtggcaagacctgtgtttgcaacgtgtgttttaaagatggcagtaagtgg
gtctgctcacttcagcacctggtcctcaagtcttctgctggtgttaaggtgaaagatgga
gcacttatagttcatctacagaagaaagagaaattcaagcaatggaaacaattgggagat
tgtgctttcacaaaagcaaagcaagagaaaggtatctccaatgcggcaaatgagaaggga
aatcccaaagaaggaacctcagtggtcagagatggagagggtgacggccagaaggatgaa
atagaggaatatgtggtgaaccatgtcaaacatagtttctttccgagacaagacctgaaa
gttatctacttccatgtgtatgtgaaaaagatcagacgggactctgtcaatgtcaccttc
acagaaaatgaaatatgcatcaaattcaagaccagcgataatcaattccttcagatgaat
tctggaagtacatcagacactttgttttgttggagaattagaccatggaggcccattgat
cctgaaggctgccatcacaaggtgacgaagagtaatctagaaattaacatcaccgcacaa
aaagcagagaaatggaaggcccttgaatgctcaactaaagaatctggagatggctctagg
ggcagggctgcgtctcagggtgactgggtacccctgtcctcctcccagacagccacgcct
cagcgtgccaaggaatcagctgaaatcactaaagatgcaggctctgagaaggagaacctg
agaggtgccgtagggggagccaagtcagtggagatcaaggagaatgtaacaaggaccaag
aaacccacgtgcacagtaccgccgttgagtttagggaagcagactccatccttgccagcc
gagcctacaccatcccttcattacgggtactgtggacttgataaccttggtaacacctgc
ttcatgaacagtgttcttcaggtcctggccaacacaagagaactcaaagacttcatgtta
ggagccgacttcaagaatgagatcaatcgggacaatcccctgggtagtggaggtcacctg
gttctctcctttgctgtcttgatgaggaggctatggggaggtcaacataaatccatcgct
ccctcaaaactcaagtccattatatcagccaaggccagtcagttcatggggtttgctcag
catgatgcacaggaattcatggcttttctcttggatggacttcatgaggacatcaacaga
atccgtaaaaagccatacactcaaacaattgattctgatggaaggcacgatgaggacatc
aacagaatccgtaaaaagccatacactcaaacaattgattctgatggaaggcacgatgag
gtttcaataacctttgaccccttcatgcacctgtccatgccactcccgaagaagaagcgt
cacttccccgtctacttcttctcccgggattgcaatcaacgaccggtcaagtacgtgctc
tctctcggctcggacgctacggtccacgatctgactgtccaggtgggtcagatggcgggg
gtcaatgctgccaatttgagggtctttgaggtccatcggagctgcatccataaggtcttt
tcccgaaggagcacactgtcgggcatgtctttcaatgacatcatctttgtgcatgaagtc
ttgtcgccagccatggcaggagagagtgttgtagagctgtctgttattcagcgtatgttg
atgccgcctgcccttctccactgttcccactgtaagaaaagctgtgagaaaggcagaagc
ctcaagagatgcaccaagtgttaccgggtagcatactgcgatcaagcttgtcagaagagc
aattggaacacgcatagacccacgtgtcgtcgtttcccagaacctgttggatgtcctttc
atcatcagtctgcccaaatctcatgccacatatgccaggctttgccagcttatggagtgt
tacgcaaggtattctaccaatgtgtttgtaccacccttgaagccaccgggcacagtaagc
agccctggtaattcctctcatgagagcgaacacccctctacctcaaccgattctcaacct
cagtccgatggagttgcaccctccactaccactacctctccagcagatgcatcaaggatt
cctaccacagagacaacgatggatgatgaagagatgggggatggacaggatgggaaggag
agaatggaggacattggtttggaagaccccattcagtcggaggaaatgggagatgggatg
atggagggaacgtctgataaagatgaggctttgaggaaaggagaaggaggaggaggggga
ggagactctggagcagagtccagaggaaattcgtcagacatggaaggagctgcaacagct
acggtggtagggcaacctcagacccaggagagaaagatgcctctgttcttcgtcaagcct
gtcaatcacataggcaacagtatccccagcaaggaacggctcacagataaaggtgatgtc
cctcttgatctgtctggtatcatcagtgtagccatggattggaggaatgatcccaaacaa
gagaacaacgtcttggtggagtcaaggacacttgactatgcagaagacgaatcagtgtgt
gggaagtcatacgaagagactgaaatcaccttggaccagtgtctcaaactgttcacggag
ccagagaagcttgctcctggggaagcatggtattgtcccaagtgcaagcaacacagagaa
gcaaccaaacagatgttactatggcgactgccctctactctcatcatccagctgaaacgg
ttctcctttggtaacatgctgtggagggacaagatcaacaaaatggttgaataccccgtc
agaggcttggatctgtctccctactgccatggttcccacggcacacctttgatctatgac
ctctatggggtcatcaaccatcatgggggtattctgggaggtcactatacgtccttcggt
agactggcttctactgcagactggagtaagaatgagcatgactggagactgtttgacgac
aatcatgtgaccactgtctctgagaagaacgtggtgacgcgttcagcctacctgctcttc
taccgccgtcgtcagccctacaccccgtacatctggcaagctcctgcagacccggagccg
gaggaggaggagccggaggtggagccccagagggagcctcagcaggagcataagagtgtg
caggagacaggggatgaaccagaggagatggatgacaagtcatccacctgcagcagtgag
atggaggtcagtgagagagacccgtctgatgcggcaggagtggagaggccaggcaaacag
ttccctcaccatgacaaccgcttctctgcctcctcccaacctcctgcccctctgcaaaca
tcttgcgttgataagaggagtcgagatggagaggacattggctacactgatatggaggat
atagactag

DBGET integrated database retrieval system