KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100891460Help
Entry
100891460         CDS       T01019                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100891460
Peptidases [BR:spu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100891460
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100891460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 400 aa AA seqDB search
MMRFRGETTSTKSHTSGDNRDGDETKPTGEVSACKKTERRRKRAIIWSWTWKLCVLNTFL
FYTIFPVLVFFIPDFASQLIFLNYLKCPVFREYQAPEVYGLKGARNVYLPSTNGVQLGVW
QMLPNSARTANDEEGEITAEFFDKALGDNRPVIMYCHGNSGSRANPHRVELYKLLTRIGF
HVVAVDYRGYGDSSSHTTPDGIHDDVQTVYTWLRKRTGDSPFYIWGHSLGTGISTVFTSK
ICREDGCPTGLILEAPFNNLLDEVMRHPFGWAWNILPYSRGYFDQAFNSTAQYFQSDISI
EHVTCPILILHAEDDWVVPHDLGKKLYDIALEKRPASAGPIKMISFGSEEGCGHKNIAFS
TKLPSVLGDFVSEEPKVWRIPIALEGEYLICLCATISCVF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggttccgcggcgaaactacctctacaaaatcccacacgagtggagataatcga
gacggagacgagacgaaacctaccggggaggtttcggcttgcaagaaaacagagaggcgg
cgaaagagagcaattatatggagctggacatggaagctatgcgtgctgaataccttccta
ttctacacaatcttcccagttcttgtctttttcatcccagactttgcatctcaactcatc
ttcctcaattacttgaagtgtcctgtattccgagaataccaagctcctgaggtatatgga
ttgaaaggagcaaggaatgtctacctcccttctactaatggagttcagcttggagtatgg
caaatgctaccaaattctgcaagaacagcaaatgatgaagagggtgaaataacagcagag
ttctttgataaagcactaggtgacaatagaccagtgatcatgtactgccatggaaattca
ggttcaagggcgaatccacacagagtagagttgtacaaattattgaccagaattggattc
catgtagtagctgtagactacagaggatatggtgactcgtcaagtcatactaccccagat
ggtattcatgatgatgtacaaaccgtctatacatggctgaggaaaaggacaggggattct
ccgttctatatatgggggcattcccttggaacagggatttccacagtgttcacttcaaaa
atatgcagagaagatggatgtcctacaggtctaatcttagaagcaccgttcaacaatctt
ctggatgaggtcatgaggcatccatttggatgggcctggaacattctgccatacagtagg
ggttactttgatcaagcttttaactctacagctcaatactttcagagtgatatcagcata
gagcatgtaacatgtcctattctcattctgcacgctgaagatgactgggtagtaccacat
gacctcggaaagaagttatatgacatagctttggagaaaagaccagcctcagcgggccca
atcaaaatgatttcatttggtagtgaagagggttgtggacataagaatattgctttctca
acaaagttaccatctgttttaggtgatttcgtcagtgaggaaccaaaagtttggagaata
ccaattgctttggagggcgaatacttgatatgcttgtgtgcaactatctcatgtgttttc
taa

DBGET integrated database retrieval system