KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100892136Help
Entry
100892136         CDS       T01019                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100892136
Enzymes [BR:spu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100892136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 284 aa AA seqDB search
MASLKFVPKEERQEQVVLARQLESSANVQLHGATVTSLTLNGCDRLFLSEKAVFNNKKAI
RGGIPVIFPQFGPWDLGAQHGFARTTPWVLTDKQTDPKKEVLCTFELEDDLETRSIWNHK
FKVKYTVALKKKNAVFDFSVTNTGLAKLEFTCLLHTYFRVDDIANVSITGLNGLEYVDKI
RGGATFTEDRDLVTVGENYDRVYQQTPNKHEIRNTIDGATIILEKNNFPDTVVWNPWAEK
AKQMSDFGDDEYTKMICVEAGHVSTPVTLQPEQTFFASQSIAVK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcttccttgaaatttgttcccaaggaggagcgccaggaacaggtggtattggccagg
cagctggagtcgtctgcgaacgtccagcttcacggagctacagtaacatctcttacactg
aatggatgtgatagattatttttaagtgaaaaagctgtgtttaataacaagaaggcgata
cggggtggtattccagtcatctttccccagtttggtccatgggatctaggagctcagcat
gggtttgctagaacaacaccttgggtcctgactgacaaacaaacagatcccaagaaggaa
gtcctttgtacatttgagctggaggatgatctagaaacacgcagtatatggaatcataaa
ttcaaggtgaaatacacagttgctctgaagaaaaagaatgctgtctttgacttttctgtc
acaaatacaggcttggctaaattagaattcacctgtcttctacacacatacttcagagta
gatgacatagccaatgtatcaataacaggcctcaatggactagagtatgtagacaagatt
cgagggggagccacattcacggaggacagggatctagtgacagtgggagaaaactatgac
agagtataccagcaaacacccaataaacatgaaatcagaaacacaattgacggagcaacc
attatcttggagaaaaacaactttcctgatacagtggtatggaatccatgggcagagaaa
gcaaaacagatgagtgactttggtgatgatgaatacactaagatgatttgtgtagaagct
ggccatgtttctacaccagtaacgctacaacctgaacaaacgttcttcgcaagtcagagc
atcgctgtcaaataa

DBGET integrated database retrieval system