KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100893519Help
Entry
100893519         CDS       T01019                                 

Definition
profilin-2-like
Orthology
K05759  
profilin
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100893519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 129 aa AA seqDB search
MATDWKTNYIDKTLMASGNLTHAAIVGLDGAIWATSDDFKISAGEVGFLIRGLATAESLR
ENGVLIGGVKYVLLRADDNAVLARKQGTGVCVGKSSTALVIGVYGTDHVAGKANNTVQEL
AQYLIGQGT
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagattggaaaacgaattacattgataaaacccttatggcgtccggcaatttg
acccatgcggccatagtcggactggatggggctatttgggcaacatcagacgactttaag
atttcggccggggaagtcggattccttattcgcggtctggccactgcggagtcattgcga
gaaaacggcgttctgattggcggggtgaaatatgtgcttcttcgagcagacgataacgct
gtcttggccaggaaacaaggcacaggagtgtgtgtaggcaaaagtagcaccgctcttgtc
atcggagtatacggaacagatcatgtagccggaaaagcgaacaataccgtacaggaacta
gcgcaatatttgattggtcaaggtacctaa

DBGET integrated database retrieval system