KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373206Help
Entry
373206            CDS       T01019                                 

Definition
alphaP integrin
Orthology
K06584  
integrin alpha 8
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    373206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1054 aa AA seqDB search
MARFLLLSFCTTLVLLDSTVAFNFDLRAPVKFDGPQGSLFGFSVAQHRDQNTDWVLIGAP
EAPTTQPGVTNGGAVYKCPVTPLSGSGPCEQVPFDTTGNTEVLDKSNQWFGATLASSGPD
GRILACAPRLVWLQTSTISPTDKEREPTGTCFVGHSDFTNFVNYSPCQSTDRDLFGFDKI
THCQAGFSAQIPSDNSTLVMGAPGSYYLQGQIFAQSLSTLSDVSNTPEQAVAFDNSYRGY
SLALGDFNGDGLEDYVVGTPRGESLRGLVAIFDQSLVEIITPVVGEQIVSYFGYSVASVD
VNGDGLDDLLVGAPMFTNREPATEKWEAGRVYVYLQNADHSLGAPQMLTGKKIRARFGFP
ITSIGDSNQDGFNDVAIGAPYDGEDNSGVVYIYHGSAEGLRLTESQVLTPSELGFSDITT
FGFSVDGGQDMDQNDYPDLVVGAESADAAILVRTRPVVLLEAELTIEPIGINLDNKTYEL
PDGTMVTSFVAMACFTYTGNHLPARIGISYTLTVDSSITSGRRALLEVNELSQVTKNRNL
DVGMKFCDPLRAYVVNTIQDKLTPIAVDLQYELTDESILLPYEILPIINKEAVSSQTKQV
SIQNNCVNNICIPEIGITVTPNLPNIVIGQAQELTLVVSINNRGEDAFQSTLAVYYPEGL
QYVRLERRANMDFSVTCTEDSALRMITCDTGNPLVGKYNLEFGLTLSTLQVSGDKDNIEF
YLVAGSENNEDPNTLDNNELNVTVAVIVDATLKLLSASYPEIVTYRVPEDNIVPEFPTKN
ASEADIGMEVVHLYEVRNTGSSNAAEVTLNIRWPEKDENGDYLFYLLGIMTDEGVTCQIS
QGQANPLGVKLEASTKEQLSNSTTQVSGRRKREGEYAEALAQAEPIFCTPESCVLINCTI
DEIKATKSKVVRILGRFWERTFQKAVSEAVPVIQVTLASTATATVRSIPYNIPLPMEFTD
STKASTLITAEELVLPPVSIAWWIIVVSVLGGIILLLIIILGLWKCGFFERKKPGEDQKE
YEPVAVTEKDGPPEVYDAPDRSSANSNTFLVCSY
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atggcacgttttctgctgctttctttttgtaccacattagttctattggatagtacagtt
gcattcaattttgatctgagggcacctgtgaaatttgatggaccgcaaggaagcttgttc
ggattcagtgtggcacaacatcgagatcaaaacacagattgggttttaataggggcgcca
gaggcccctaccacccagcccggggtgaccaatgggggcgctgtttataagtgtcccgtc
acccctctcagcggcagcggcccatgcgaacaagttccctttgatacgaccggtaacaca
gaggtcttggacaagtctaaccaatggttcggagctacgctggcaagctctgggcctgac
ggccgcatcctggcttgtgctcctcggttagtctggcttcagacttccactatttccccc
accgacaaggaacgtgagcccacgggaacgtgtttcgtcggacactccgatttcaccaac
tttgtgaactactccccgtgccagagcacagatagagatctgtttggatttgataagatc
acccattgtcaagctggattcagtgcacaaataccaagcgataacagtacattggtcatg
ggagctcctggaagctactatttacaaggtcaaatctttgcccaaagtctctccacgtta
agtgatgtaagcaacacgccggagcaagcagtggcatttgataacagctacaggggttat
tccctcgctcttggtgacttcaatggtgacggacttgaagactacgttgtgggtacacct
aggggggagtctcttcggggactggtggccatctttgaccagagtttggttgagatcatt
acccctgttgttggggagcagatagtctcctattttggatacagtgttgcttccgttgat
gtcaatggcgatggccttgacgacctgctggtaggagcacccatgtttacaaaccgtgag
ccggctacagagaagtgggaagcaggacgggtgtacgtgtatctacagaacgcagatcat
tccttaggagctcctcaaatgctgacaggaaagaagatcagggctcgctttggcttccca
atcacatccatcggtgactcaaaccaagatggattcaatgatgttgccattggagctccc
tatgatggtgaggacaactcaggggttgtttacatctatcatggcagcgcagaaggactt
agactgacagagtctcaggtgttgaccccatccgaacttggcttcagtgacatcacaacg
tttggtttctcggtcgatggcggacaagacatggaccaaaacgattatcccgatcttgtg
gttggggcagagagtgcggacgctgccattcttgtaaggactcgaccagtggttttgctg
gaagcggaactcaccattgagcccatcggaatcaaccttgacaacaaaacctacgagctt
cctgacggtaccatggtaaccagtttcgttgctatggcgtgcttcacttacaccggtaat
catcttcctgcccgcattggcatcagctacaccttgacggtggattctagtatcaccagc
ggtagaagggcgctgttggaagtcaacgaactgagccaagtcacaaagaatcgaaacctc
gacgttgggatgaagttctgcgaccctctccgagcatacgtcgtgaacaccatccaagac
aagcttactcccatcgctgtcgatcttcagtacgagctgacggatgagtccatcctcctg
ccctatgagatcctacccatcatcaacaaggaggctgtgtcttcacaaactaagcaggtg
tccattcagaacaactgtgtcaataacatctgtatccctgaaattggcatcacagtcaca
cctaatctcccgaacattgtgatcggccaggcccaagagttgactctagtagtatccata
aacaaccgaggggaagatgcgttccaatctacgctcgccgtctactacccggaagggctt
cagtatgtcaggctggagaggagagctaacatggacttttctgttacatgcactgaggac
tctgctcttcgcatgatcacctgcgacacaggaaacccattggtcggcaaatacaatctt
gaatttggcctgactttgtctaccttgcaagtcagtggagataaagataacattgagttc
tatctggtagccgggagtgagaacaatgaggatccaaacacactagacaacaatgaactg
aacgtgacagtcgctgttattgtagatgctaccctcaagttgctcagtgcgtcttatcca
gaaattgtgacttaccgtgtgccagaagacaacatcgtacctgaattcccaaccaagaat
gcatcagaggctgacattggcatggaagtggtgcatctttatgaggtccgtaacacaggc
tcaagcaatgctgccgaggtcacactgaacatcagatggcccgagaaggatgagaacgga
gactatcttttctatctcttgggaataatgacagacgaaggggtgacgtgccagatctct
caaggacaagctaacccactgggagtcaagctcgaagccagcacaaaagaacagctctcc
aactcgacgacgcaggtcagcggtcgccgaaaacgcgagggggagtatgccgaagctctg
gcccaggcagaacccattttctgcaccccagaatcctgcgttctcatcaactgcaccata
gatgagatcaaggccactaagagcaaagtggtgcggatcctgggacgcttctgggagagg
acattccagaaggctgttagcgaggcggtgcctgtcatacaagtaaccttagcatctact
gcaactgctaccgtgaggtcgattccttacaacatacccctccccatggagttcactgac
tcaaccaaggcatcaaccctgatcacagctgaagagttagtgcttcctccagtcagcatc
gcctggtggatcatcgtagtgtctgtgctgggaggcatcatcttactcctcatcatcatc
ttaggattatggaagtgtggcttcttcgagaggaagaaacctggagaagaccagaaggaa
tacgagccggtcgccgtcacggagaaagacggtccgcccgaggtgtatgacgcaccagac
cgctcgtcagctaactctaacaccttcctagtctgttcttattga

DBGET integrated database retrieval system