KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373289Help
Entry
373289            CDS       T01019                                 

Gene name
cdk4
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02091  
cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     373289 (cdk4)
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   373289 (cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 373 aa AA seqDB search
MASSVPSRSTPERYVQAAEIGSGAYGIVYKARDTETGHFVALKSVRIPIGEEGMPVSTIR
EISLLRHLCQLDHPNIVKLLDVCDVMDVGRSEMMLTLVFELVDQDLAQYLEKCPPPGLSS
CTIKFLMHQLLSGVEYLHSHRVTHRDLKPQNILVASDKKLKLTDFGLSRVYSFQMALTPV
VVTMWYRAPEVLLQASYATPVDMWSVGCIFAELYRRRPLFRGQSDKDQLHKIFEVIGLPP
EDQWPDVALPWSSFRQTGQRSFLDLVQEICNQGLDLLERMLCFNPDHRMTAEQGLLHGFF
GDEEEDDEEDDDTEVEDDDDEEDEDDEGVDVGQERSQSASTSSMSQATDDSGSHSQFFSD
SSQSQDVTPTNKR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctctgtgccttcccggtcgacgcccgagcgttacgttcaggccgcggagatt
ggaagtggagcttatggcattgtgtacaaggccagggacacggaaacgggccactttgtg
gccttgaagagcgtaaggataccgattggtgaggagggcatgccggtatccaccattaga
gagatatccttgctcagacatctctgccagctagaccatcctaatattgtcaaacttctt
gatgtttgtgatgtgatggatgttggtagatcagagatgatgttgactctggtctttgag
cttgtggaccaggacctggcccagtacctcgagaagtgtcctcctccaggattaagttct
tgtacaatcaagtttttgatgcatcagcttctaagtggtgtagaataccttcactctcat
cgtgtcactcacagagatctgaaaccacagaacattcttgtcgctagtgataagaaattg
aagctaacagactttggtttgtctcgtgtctacagtttccagatggctctaactccagtg
gtggtgaccatgtggtacagggcacccgaagtcctcctccaggctagctatgccacaccg
gtcgacatgtggagtgttggatgcatatttgcagagctttataggagaaggcctctattc
aggggacagtcggataaggaccaacttcataaaatatttgaggttattgggcttccaccc
gaggaccagtggccagatgttgctcttccgtggagttccttccgtcagactggacagaga
tccttcctagacctggtccaggagatatgcaatcaaggactggatctactagagcgaatg
ctgtgtttcaatccagaccatcggatgacggcggagcaaggcctgttacatggcttcttt
ggtgatgaggaggaggatgatgaggaggacgatgataccgaagtggaggatgatgacgat
gaagaagatgaagacgatgagggagtggatgtcggtcaggagcgtagtcaatccgcatca
acttcaagcatgagccaagctacagatgattctggttcacattcacagttttttagcgat
tcctcacagtctcaagatgtcacaccaaccaataaacgatga

DBGET integrated database retrieval system