KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373305Help
Entry
373305            CDS       T01019                                 

Gene name
ECaSt/PDI
Definition
ER calcistorin (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:spu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 496 aa AA seqDB search
MKYLALCFIALACAVHAAVEVEIEEDVAVLTDAAFADYVAENEFVLVEFYAPWCGHCKSL
APQYSIAAKTLKDSGSSIKLAKVDATVETQLPGKYGVRGYPTLKFFRSGKDSEYAGGRTG
PEIVAWLNKKTGPPAATIASVEDAEAFLADKEVAVIGFFKDVPQTFLDVAVNIDDIPFAI
VSDDAVISNYEAKDGSIILFKKFDEGKNVFEGELTSEDLTSFVRKNSLSVVTEFGEETAS
KIFGGEIKIHNLLFVKKDSDDFKTIYDQFYAAATTFKGEVLFVLIDAAAESNSRILEYFG
LGDEEVPTVRLITLDGDMKKYKPTVPELTTESLSQFVIDFKDGKLKPHLMSESVPEDWNA
NPVTILVGENFAEVALDPTKDVLVEFYAPWCGHCKQLAPIYEELGEHFKEREDVVIAKVD
STKNEVEDAVVRSFPTLKFWKKGENEMVDYSGDRTLEAMIQFVESGGEIIAEVDDEDMEE
DEEMDEGAEDQAKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttggctctttgttttattgctctggcctgtgcggtccatgccgcagtcgag
gtcgaaatcgaagaagatgtcgctgtcttgacggatgctgccttcgccgattacgtcgca
gaaaatgaattcgtccttgtagaattttatgctccatggtgtggacattgcaagtctcta
gctcctcagtattcaatagctgccaaaactctcaaagacagcggatccagcataaaacta
gccaaggtggatgcaacggtcgagacccaactgccgggaaaatatggagtcaggggatat
cccactctcaagttcttcaggtccggaaaagatagtgaatatgcaggaggaaggacaggg
ccagaaatcgttgcttggctgaacaagaagaccggaccacctgctgccaccattgcatcc
gttgaagacgccgaggctttcctcgctgacaaggaagttgccgtcattggattcttcaag
gatgtcccccagacattcctggatgttgctgttaacattgatgatattccatttgcaatc
gtctctgatgatgccgtgatctcaaactacgaagctaaagatggcagcattattcttttc
aagaagtttgatgaaggcaagaatgtgtttgaaggtgagcttacctcagaggatttgacc
agctttgtgaggaagaacagcctgtcggttgtcaccgagttcggagaagagactgccagc
aagatctttggaggagagatcaaaatccacaacctactcttcgtcaagaaggactccgat
gacttcaagaccatctacgatcagttctatgctgctgctaccaccttcaaaggagaggtt
ctttttgttctcattgatgctgcagcagagtctaactccaggatcctagaatactttggt
cttggtgacgaggaggtccccactgtccgtctcatcaccctcgacggcgacatgaagaaa
tacaaacccaccgtacctgaactcaccacagaatcactctctcagtttgttattgacttc
aaagacggcaaactcaagcctcatctgatgtcagagtctgtccctgaagactggaacgcc
aacccagtcaccattcttgtaggagaaaactttgccgaagtcgcacttgatcctactaaa
gacgtccttgttgaattttatgccccatggtgtggacattgtaaacagcttgctcccatt
tatgaggagcttggagaacatttcaaggaaagagaagatgtagttattgccaaggtggat
tcaactaaaaatgaagtagaagatgctgtcgttcgcagcttccccacactcaagttctgg
aagaagggagaaaatgagatggtcgattatagtggcgatagaacattggaggccatgatc
cagtttgtcgagtcaggcggagaaataatcgccgaggtcgatgatgaggacatggaggag
gatgaggagatggacgagggagccgaggatcaagccaaggatgaactttaa

DBGET integrated database retrieval system