KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373305Help
Entry
373305            CDS       T01019                                 

Gene name
ECaSt/PDI
Definition
ER calcistorin (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    373305 (ECaSt/PDI)
Enzymes [BR:spu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     373305 (ECaSt/PDI)
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   373305 (ECaSt/PDI)
  Exosomal proteins of colorectal cancer cells
   373305 (ECaSt/PDI)
  Exosomal proteins of bladder cancer cells
   373305 (ECaSt/PDI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 496 aa AA seqDB search
MKYLALCFIALACAVHAAVEVEIEEDVAVLTDAAFADYVAENEFVLVEFYAPWCGHCKSL
APQYSIAAKTLKDSGSSIKLAKVDATVETQLPGKYGVRGYPTLKFFRSGKDSEYAGGRTG
PEIVAWLNKKTGPPAATIASVEDAEAFLADKEVAVIGFFKDVPQTFLDVAVNIDDIPFAI
VSDDAVISNYEAKDGSIILFKKFDEGKNVFEGELTSEDLTSFVRKNSLSVVTEFGEETAS
KIFGGEIKIHNLLFVKKDSDDFKTIYDQFYAAATTFKGEVLFVLIDAAAESNSRILEYFG
LGDEEVPTVRLITLDGDMKKYKPTVPELTTESLSQFVIDFKDGKLKPHLMSESVPEDWNA
NPVTILVGENFAEVALDPTKDVLVEFYAPWCGHCKQLAPIYEELGEHFKEREDVVIAKVD
STKNEVEDAVVRSFPTLKFWKKGENEMVDYSGDRTLEAMIQFVESGGEIIAEVDDEDMEE
DEEMDEGAEDQAKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttggctctttgttttattgctctggcctgtgcggtccatgccgcagtcgag
gtcgaaatcgaagaagatgtcgctgtcttgacggatgctgccttcgccgattacgtcgca
gaaaatgaattcgtccttgtagaattttatgctccatggtgtggacattgcaagtctcta
gctcctcagtattcaatagctgccaaaactctcaaagacagcggatccagcataaaacta
gccaaggtggatgcaacggtcgagacccaactgccgggaaaatatggagtcaggggatat
cccactctcaagttcttcaggtccggaaaagatagtgaatatgcaggaggaaggacaggg
ccagaaatcgttgcttggctgaacaagaagaccggaccacctgctgccaccattgcatcc
gttgaagacgccgaggctttcctcgctgacaaggaagttgccgtcattggattcttcaag
gatgtcccccagacattcctggatgttgctgttaacattgatgatattccatttgcaatc
gtctctgatgatgccgtgatctcaaactacgaagctaaagatggcagcattattcttttc
aagaagtttgatgaaggcaagaatgtgtttgaaggtgagcttacctcagaggatttgacc
agctttgtgaggaagaacagcctgtcggttgtcaccgagttcggagaagagactgccagc
aagatctttggaggagagatcaaaatccacaacctactcttcgtcaagaaggactccgat
gacttcaagaccatctacgatcagttctatgctgctgctaccaccttcaaaggagaggtt
ctttttgttctcattgatgctgcagcagagtctaactccaggatcctagaatactttggt
cttggtgacgaggaggtccccactgtccgtctcatcaccctcgacggcgacatgaagaaa
tacaaacccaccgtacctgaactcaccacagaatcactctctcagtttgttattgacttc
aaagacggcaaactcaagcctcatctgatgtcagagtctgtccctgaagactggaacgcc
aacccagtcaccattcttgtaggagaaaactttgccgaagtcgcacttgatcctactaaa
gacgtccttgttgaattttatgccccatggtgtggacattgtaaacagcttgctcccatt
tatgaggagcttggagaacatttcaaggaaagagaagatgtagttattgccaaggtggat
tcaactaaaaatgaagtagaagatgctgtcgttcgcagcttccccacactcaagttctgg
aagaagggagaaaatgagatggtcgattatagtggcgatagaacattggaggccatgatc
cagtttgtcgagtcaggcggagaaataatcgccgaggtcgatgatgaggacatggaggag
gatgaggagatggacgagggagccgaggatcaagccaaggatgaactttaa

DBGET integrated database retrieval system