KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373323Help
Entry
373323            CDS       T01019                                 

Gene name
H2B-1
Definition
histone H2B-1, sperm specific
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   373323 (H2B-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 140 aa AA seqDB search
MPSQRSPTKRSPTKRSPQKGAGKGGKGSKRGGKARRRGGAAVRRRRRRRESYGIYIYKVL
KQVHPDTGISSRGMSIMNSFVNDVFERVAAEASRLTKYNRRSTVSSREIQTAVRLLLPGE
LAKHAVSEGTKAVTKYTTSR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcagaggagtcctaccaagcgaagtccgaccaaacgtagcccccagaaggga
gctgggaagggaggcaagggatccaaacgaggaggaaaggccaggcgtcgtggtggagcc
gctgtaaggagacgtcgacgaagacgcgagagctatggaatctacatctacaaagtgttg
aagcaagttcatcccgacactggcatttctagccgcggcatgtccatcatgaacagtttt
gtcaacgatgtgtttgagcgcgtcgctgccgaagcttcccgtcttaccaagtacaaccgc
aggagcaccgtttcaagccgcgagatccagaccgctgtccgccttcttctccctggagag
ctggccaagcacgccgtttctgaaggcaccaaagctgtcaccaaatacaccacgtctcga
tag

DBGET integrated database retrieval system