KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373336Help
Entry
373336            CDS       T01019                                 

Gene name
H2B
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   373336 (H2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 124 aa AA seqDB search
MAPTAQVAKKGSKKAVKGTKTAXGGKKRNRKRKESYGIYIYKVLKQVHPDTGISSRAMVI
MNSXVBDIFERIAGESSRLAQYNKKXTXSSREIQTAVRLILPGELAKHAVSEGTKAVTKY
TTSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggctccaacagctcaagttgctaagaaaggctccaagaaggcagtcaaaggcaccaag
acggccngcggtggcaagaagaggaacaggaaaaggaaggagagttatggaatctacatc
tacaaagtcctcaagcaggttcatccagataccggcatctccagtcgggccatggtcatc
atgaacagctnngtyracgacatcttcgagcgaattgccggcgaatcttcccgcctcgct
cagtacaacaaaaagtyracnntcagcagtcgcgagattcagaccgccgtccgcctcatt
ctccccggagagctggcaaagcacgctgtgagcgagggtaccaaggcagtgacgaaatac
actacctccaagtag

DBGET integrated database retrieval system