KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373336Help
Entry
373336            CDS       T01019                                 

Gene name
H2B
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 124 aa AA seqDB search
MAPTAQVAKKGSKKAVKGTKTAXGGKKRNRKRKESYGIYIYKVLKQVHPDTGISSRAMVI
MNSXVBDIFERIAGESSRLAQYNKKXTXSSREIQTAVRLILPGELAKHAVSEGTKAVTKY
TTSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggctccaacagctcaagttgctaagaaaggctccaagaaggcagtcaaaggcaccaag
acggccngcggtggcaagaagaggaacaggaaaaggaaggagagttatggaatctacatc
tacaaagtcctcaagcaggttcatccagataccggcatctccagtcgggccatggtcatc
atgaacagctnngtyracgacatcttcgagcgaattgccggcgaatcttcccgcctcgct
cagtacaacaaaaagtyracnntcagcagtcgcgagattcagaccgccgtccgcctcatt
ctccccggagagctggcaaagcacgctgtgagcgagggtaccaaggcagtgacgaaatac
actacctccaagtag

DBGET integrated database retrieval system