KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373349Help
Entry
373349            CDS       T01019                                 

Definition
late histone L3 H2b
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   373349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 123 aa AA seqDB search
MPAKAQAAGKKGSKKAKAPKPSGDKKRRRKRKESYGIYIYKVLKQVHPDTGISSRAMSIM
NSFVNDVFERIAAEASRLAHYNKKSTITSREVQTAVRLLLXGELAKHAVSEGTKAVTKYT
TSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaaagcacaagccgctggaaagaagggatcgaagaaggctaaggcccccaag
cctagcggagacaagaagaggagacgaaagaggaaggaaagctacggaatctacatctac
aaggttctgaagcaggttcaccccgacactggtatctccagccgtgccatgtccatcatg
aacagcttcgtcaacgatgtcttcgagcgcatcgccgccgaggcttcccgccttgcccac
tacaacaagaagtccaccatcaccagtcgtgaggtccagaccgctgtcagactcctcctc
nccggagagctggccaagcatgccgtctctgagggcaccaaggctgtcaccaagtacacc
acctccaagtaa

DBGET integrated database retrieval system