KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373349Help
Entry
373349            CDS       T01019                                 

Definition
late histone L3 H2b
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 123 aa AA seqDB search
MPAKAQAAGKKGSKKAKAPKPSGDKKRRRKRKESYGIYIYKVLKQVHPDTGISSRAMSIM
NSFVNDVFERIAAEASRLAHYNKKSTITSREVQTAVRLLLXGELAKHAVSEGTKAVTKYT
TSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaaagcacaagccgctggaaagaagggatcgaagaaggctaaggcccccaag
cctagcggagacaagaagaggagacgaaagaggaaggaaagctacggaatctacatctac
aaggttctgaagcaggttcaccccgacactggtatctccagccgtgccatgtccatcatg
aacagcttcgtcaacgatgtcttcgagcgcatcgccgccgaggcttcccgccttgcccac
tacaacaagaagtccaccatcaccagtcgtgaggtccagaccgctgtcagactcctcctc
nccggagagctggccaagcatgccgtctctgagggcaccaaggctgtcaccaagtacacc
acctccaagtaa

DBGET integrated database retrieval system