KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373409Help
Entry
373409            CDS       T01019                                 

Gene name
Coel1
Definition
profilin
Orthology
K05759  
profilin
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Proteins found in most exosomes
   373409 (Coel1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 142 aa AA seqDB search
MSWDSYVDNLIAQSKDASGTTHCDKACIIGKDGSAWTTMPTSDTSNNLKLTPEEMANIAK
CFKSKDFAAFMSSGIYVNGTKYQFLREEDSKLVLGKKKGEGSLTLQSSKTAIVIGHCPEG
GQQGNLNKAVGVIAEYLESLSM
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggattcatacgtcgacaatcttatagctcagtccaaagatgcgtcaggtacc
acccattgcgacaaggcctgtataatcggtaaagatggatctgcttggaccacgatgccg
acatccgataccagtaacaatttaaagctaaccccggaagagatggcaaatatagcaaaa
tgtttcaagtcgaaggatttcgcagctttcatgtcctctggtatatatgttaacgggaca
aaataccaattcttaagggaagaagactcaaagttggtgttggggaaaaagaaaggtgaa
ggatcactcacattgcaaagcagcaagacagcgattgtaatcggtcattgcccagaagga
ggccagcaagggaatttgaataaagcagttggcgtaatagcagaatatttggagagtttg
agtatgtaa

DBGET integrated database retrieval system