KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373525Help
Entry
373525            CDS       T01019                                 

Definition
MAP kinase (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    373525
   04068 FoxO signaling pathway
    373525
   04150 mTOR signaling pathway
    373525
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    373525
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     373525
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   373525
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   373525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 369 aa AA seqDB search
MADQGGAKTKRTNEEKPETVRGQVFDVGPRYVTLNYIGEGAYGMVCSAVDTRHGGKVAIK
KISPFEHQTYCQRTLREIKILTRFNHENIINIQDIIKADTIEAMRDVYIVQSLMETDLYK
LLKTQPLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIA
DPGHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYL
DQLNHILGVLGSPSQDDLKCIINEKARAYLQGLPFKSKIPLKSLFPKADNKALDFLERML
SFNPDKRITVEEALAHPYLEQYYDPDDEPVKEEPFTFVTELDDLPKEKLKEMIFEEASKF
NPSPSPNTS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaaggaggtgcaaaaactaagcggaccaacgaagagaaacctgaaactgtg
agaggacaagtcttcgatgtcggtccacgctatgttaccctgaactacatcggggaaggg
gcttatggaatggtttgtagtgcggtggatacacgacacggaggcaaggtggctatcaag
aagatcagtccgtttgagcaccagacatactgccaacgaaccctcagagagattaaaatc
cttacacgcttcaatcatgaaaatattattaatatccaagatatcatcaaggcagacaca
attgaagccatgagagatgtatatattgttcaaagtctaatggaaacagacctgtacaaa
ctgctcaagacccagccgctgagcaacgaccacatctgctacttcctctaccagatcctt
cgagggctcaagtacatccactcggccaacgtgcttcacagggacctcaaaccaagcaac
ctgctgctcaatactacctgtgatctcaagatctgcgactttggacttgcacggatagct
gaccccggccacgaccacacaggtttcttgacggaatacgtagcgacgcgatggtaccgc
gcccccgagatcatgctgaattccaagggttacaccaagtccattgacatctggtcggtc
ggttgcattctggctgagatgttgagcaacagacccatctttcctggaaaacattatctg
gatcagttgaaccacatcctgggagttctaggttcgccatcccaagacgacctgaaatgc
atcatcaacgagaaggccagagcctacctccagggactaccgttcaagtccaagattccc
ctcaaatcactcttcccgaaggctgataacaaagctcttgatttcttggagaggatgctt
tccttcaaccctgacaagaggataactgtagaggaagctctagcacatccctacctggaa
caatactatgatccagatgatgagcctgtcaaagaagagccgttcacatttgtcacggag
ctggatgatttaccaaaggagaaactgaaagagatgatctttgaagaagccagtaaattc
aacccatccccaagcccaaatactagctga

DBGET integrated database retrieval system