KEGG   Strongylocentrotus purpuratus (purple sea urchin): 494023Help
Entry
494023            CDS       T01019                                 

Gene name
plcd
Definition
phospholipase C delta isoform
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    494023 (plcd)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    494023 (plcd)
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     494023 (plcd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 753 aa AA seqDB search
MGENPGQVEQIHQKLKRGTKFTKISPNSTKKHGRTFSLTDDGTALMYTPSKKSSSKATVS
LSEIHEIRSGHETDTFRISKNKKKYPKERSFSLIVGNENHTVNLVAPSQDDARTWVMGLR
WLKKKSQHIDIHSKQAAWIMDAFRQADVDRDGTVDFDESYKLLKKLNIKIEKVHAKRLFQ
FANTHSTTTKKGKVRSDALSEDEFVEFYRIITRRPDLQEVFKKYSGDDDYWTPEEFAEFM
HEEQKRLEVTPEWCATNIEEYEPNQEFRDQKILTMDGFFLFMMGPSGLIFNPFHEDVYQD
MKQPLAHYFINSSHNTYLLDDQLRGPSSTEAYISALQRGCRCVELDCWDGPDNDPIVYHG
HTLTSKIKFRDIIEVVDKYAFAASEYPLILSFENHCSVEQQKVMAQICVSILKDKLYTNN
NLHNEAAFPSPEELKGKILIKGKSLPPSAATTEDDGEVSDEDEAADIDTEDPQLKAELDK
KKTTSKKKLKLAKELSDLVTLASVHYGSFPASKEKYKCHQMSSFGEAKAFGLAEDKPGDY
VEHNKIFLSRIYPGGLRTNSSNYSPVPMWDVGAQIVALNFQTPCEEMDLNQGKFLQNGKS
GFILKPVFCRKPNMQFNPLKPGDQYTQHVTLTVISGQQLPKPSGSKEVIDPYVKVYVLGG
GSKQEFKTEVVENNGFSPTWNQEFSFEVKVPELALIRLVVQDYDMASSNEFIGQYTFPVA
SMQLGYHHVPILGEKGDDLLPASLFIHTMVNVS
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgggagagaatccaggacaagttgaacagattcaccagaagctgaagcgtggcaccaag
ttcaccaagatatctccgaacagcaccaagaagcacggcaggaccttctctctgactgat
gatggtactgctctcatgtacaccccatctaagaagtcctccagcaaagcaacagtgtcc
ctttcggagatccatgagatacgcagcggacacgagacagacacattccgcatctctaag
aacaagaagaagtaccccaaggaacgctctttttctctcatcgtcggcaacgaaaatcac
accgtcaaccttgtagcgccctctcaagatgacgccaggacatgggtcatgggactgcgt
tggctgaagaagaagtcgcagcatattgatatccactccaagcaggctgcatggatcatg
gatgcctttagacaggcggacgttgatcgagatggaacggtggactttgatgagtcctac
aaactcctcaagaagctcaacatcaagatcgagaaggttcacgccaagagattattccag
tttgcaaacacacattcaactaccacgaagaaaggaaaagtgaggagcgacgctctcagc
gaggatgaatttgtagagttctatcgtatcatcacgcgccgtccagacttgcaagaggtc
ttcaaaaagtactctggcgacgatgattactggacccccgaggagtttgccgagttcatg
catgaagaacagaagaggttagaggtcacaccggagtggtgcgctactaacattgaggag
tatgaacccaaccaggagttcagagaccagaagatcctcacaatggacggtttcttcttg
tttatgatggggcccagtggactcatcttcaacccattccatgaagatgtctaccaagat
atgaagcaaccactggctcattacttcatcaactcatcccacaacacatatttgttggat
gatcagctcagaggaccaagcagtaccgaagcttatatcagtgcactgcagagaggatgc
agatgtgtagaactggattgctgggatggaccagataacgaccccatcgtctaccacggc
cacaccctcacatccaagatcaagttccgagacatcattgaagtggtagacaaatatgcc
ttcgcagcatccgagtatcctttgatactgtcctttgagaaccattgcagtgtggagcaa
cagaaggtgatggctcagatctgcgtttcaatactcaaggataagctttacaccaataac
aaccttcacaacgaggcggccttcccatctccagaggaactcaaagggaaaatccttatc
aagggtaagagtcttcccccatctgccgccaccacagaggatgatggtgaagtcagtgat
gaagatgaggccgccgacatcgacaccgaagaccctcagctcaaggccgagctggacaag
aagaagacaacctccaagaaaaagttgaagttggccaaggaactgtccgatctagtgacc
ctcgccagtgtccactacggctctttccctgcatcaaaggagaaatacaagtgccaccag
atgtcttccttcggagaggctaaggccttcggtctggccgaggataagccaggggattac
gtggagcacaacaagatcttcctgagtaggatctaccccggcgggctcaggaccaactcc
tccaactatagccccgtacctatgtgggatgtgggtgctcagattgttgctttgaacttc
cagacaccatgtgaagaaatggatctcaatcaaggaaagttcctccagaatggcaagtct
ggattcatcctgaaaccagtcttctgtaggaaacccaacatgcagttcaaccccctcaag
ccaggagatcaatacacacagcatgttacacttactgtgatcagtggtcagcagctcccc
aagccatccggtagtaaagaggtcattgacccctacgtcaaggtctatgtgctaggagga
ggatccaagcaggagttcaagacagaggtcgtcgagaacaatggcttcagtcccacatgg
aaccaggagttcagctttgaagtcaaggtgcccgagctagccttgatcaggctggtggtc
caggactacgacatggcatcctccaacgagttcatcggccagtacaccttcccggtggcc
tccatgcaacttggctaccatcatgtccctatattgggcgagaagggcgatgacctcctg
ccggccagtctcttcatccacaccatggtcaatgtatcatag

DBGET integrated database retrieval system