KEGG   Strongylocentrotus purpuratus (purple sea urchin): 548616Help
Entry
548616            CDS       T01019                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    548616
   01230 Biosynthesis of amino acids
    548616
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    548616
   00051 Fructose and mannose metabolism
    548616
   00562 Inositol phosphate metabolism
    548616
Enzymes [BR:spu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     548616
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   548616
  Exosomal proteins of bladder cancer cells
   548616
  Exosomal proteins of melanoma cells
   548616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 250 aa AA seqDB search
MASGRRFWVGGNYKMNGSKASIDGLLKMLEESQIPGNTDVVVAPPTVYLDYMNSKIPAGV
FVAAQNCYKVPKGAFTAETSPAMLQDLGVGWVILGHSERRHVFGESDELIAQKVAHALSC
KLKVVACIGEKLDEREKGQTNEVVYRQMRALADVITDWGNVVIAYEPVWAIGTGKTATPQ
QAQEVHQNLRSWLTEHVNAAVAANTRIVYGGSVNGGNCCDIGQQPDVDGFLVGGASLKPE
FKQIIAAGSA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtggaagacgtttctgggttggtggaaactataagatgaatgggagcaaggcg
tcaatcgacggacttctgaagatgctggaagaatcccagattcctggaaacaccgatgtt
gtcgttgcgccacccactgtctacctcgactacatgaactccaagatcccggcaggagtc
tttgtggctgcccagaactgctacaaggtccccaaaggagccttcacggcggagacatcc
cctgccatgctgcaggacctgggcgtaggatgggtgatcctgggccactctgagaggagg
catgtctttggagagtctgatgagttgattgcacagaaggtcgcccatgctctcagctgc
aaactcaaggtggtggcatgcatcggagagaagctggatgagagagaaaagggtcagacc
aacgaggtagtctatcgccagatgagagctttagccgatgtgatcactgactggggcaac
gtagtcatcgcttacgagccggtctgggccattgggacgggtaagacggccacgccacag
caagcacaggaggtccatcaaaacctgcgctcttggttaacagaacatgtgaatgcagca
gtcgcggccaatacacggattgtatacggaggttcagtaaatggtggtaactgctgtgac
ataggacagcaacctgacgtagatggcttcctggtgggcggggcatcgctgaagcccgag
ttcaaacagatcatcgctgcaggaagcgcataa

DBGET integrated database retrieval system