KEGG   Strongylocentrotus purpuratus (purple sea urchin): 548617Help
Entry
548617            CDS       T01019                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    548617
   01230 Biosynthesis of amino acids
    548617
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    548617
   00030 Pentose phosphate pathway
    548617
   00051 Fructose and mannose metabolism
    548617
   00052 Galactose metabolism
    548617
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     548617
Protein phosphatases and associated proteins [BR:spu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     548617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 842 aa AA seqDB search
MTDPGSPTKRLRQDPIPESSPVHVGGDDVFTSPIREQLMQHSTSASHLQRRQTLSYDMVD
TVGQFSARGEGFNMVGEGKCIAVFTSGGDSQGMNAAVRSVARIGIYVGFKVYAIHEGYQG
MCDGGDHIKELSWSDVSNIIQLGGTVIGSARCKDFRERDGRKKAAMNLIKKGINNLVVIG
GDGSLTGANVFRQEWGNFVAELSKEGKITSEEAKACEYLNVVGMVGSIDNDFCGTDMTIG
TDTALHRILEAVDAISTTASSHQRCFVLEVMGRHCGYLALVAGLASAADWIFIPEMPPDA
GWENKICNKLQQTREFRKRLNIIIVAEGACTQEGDPITANLIKDLIIKRLGFDTRVTVLG
HVQRGGNPSAFDRILGCRMGAEAVLSLVDTKPDMPAYVVSLDGNKAIRVPLMDCVRKTQA
VGEALRAKDFKKACSLRGRSFLSNLSIYLTLSRIKPKEEVCSLDGRLCASNHNLAVMNVG
APAAGMNATVRAFIRTSLFQGYRVYRITDGFEGLIADKVQLSGWMDVSDWVRQGGSLLGT
NRTTPKKDMAAVAEKIKKYNIHALLMIGGFEAYMSAIQMLEARKQYPELCIPVVVIPATV
SNNVPGTDFSLGCDTALNAIADICDRIKQSASGSKRRVFIVETMGGYCGYLATMSGLAGG
ADAAYIFEEPFTIRDLELDVTHLAAKIADGVQRGLILRNEKASSNFTTEFLQRLYSEEGK
HLFTTRMNVLGHMQQGGSPTVFDRNMGTKLGVKASNFLQEKVKEFSKDGGVFTDSDDTVC
LLGISQRVVGFTPVKLLEKYTDFEHRIPKNQWWMKLRPLLRILAKHVEIYEAETEGVAQP
IE
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgacggatccaggctcgccgacgaagcggctacggcaagacccaatacccgagtctagc
ccggtgcacgtgggaggggacgacgtattcacatcgcccatcagagaacagttgatgcag
cacagtacaagtgcatcgcacttacaaagacgtcaaaccttgtcatacgacatggtggat
acagtgggacagttttcagcaagaggagagggctttaatatggtgggagaaggaaaatgc
attgcagtattcacaagtggaggtgattctcaaggtatgaatgcagctgtgagatctgtt
gcacgtatagggatctatgttggattcaaggtctatgcaatacatgagggttaccaaggg
atgtgtgatggaggcgatcatatcaaggagctttcttggtcagatgtttctaatatcatc
cagctgggtggtaccgtgatcgggagtgctcgctgcaaggacttcagggagagggacgga
agaaagaaggctgccatgaacctcatcaagaaaggcatcaacaacctggtggtcatcggg
ggagacggtagcttgactggtgctaacgtcttcagacaagagtggggcaactttgtagca
gaactctccaaagaaggcaagataacttcagaagaggctaaagcttgtgaatacctcaac
gtcgttggcatggtgggttccatcgacaatgatttctgtggtactgacatgaccataggc
acagacactgcactgcacaggatcttagaggcagtggatgcgatcagtactacagcatca
agccatcaacgctgctttgtactggaggtcatgggtcgtcactgtggttacctagccttg
gttgcaggcttggcatccgctgccgattggatcttcatccctgaaatgccaccagatgct
ggctgggaaaataagatctgtaacaaacttcaacagacccgagagttccgcaaacgtctg
aacatcatcatcgtagcagagggtgcctgcacacaggaaggtgatccaatcacagctaac
ctcattaaggatctgattatcaaacgtctagggtttgacaccagagtgactgttcttggt
cacgtccagcgaggcggtaacccatcggcctttgacagaatcctggggtgtaggatgggt
gctgaagcagtactgtctctggtagataccaagcctgacatgccagcctatgtggtatct
ctagacggtaacaaggctatacgggttcctctcatggactgtgttagaaagactcaggcg
gttggtgaggctttgagagcgaaagacttcaagaaggcatgctctctgagaggaaggagt
tttttgagcaatctaagcatttacctgacactatcccgaatcaagcccaaggaggaggtg
tgcagcttggatggtagactttgtgctagcaatcacaacttggctgttatgaacgtcgga
gcacctgcagctggcatgaatgcaactgtgagggcgtttatccgaacgtctctcttccag
ggatatagggtctaccgcatcaccgacgggtttgaagggcttatcgctgacaaggttcag
ctatctggctggatggatgtgagtgattgggtgcgacaaggaggctctctacttggaaca
aacaggacaactccaaagaaggacatggctgctgttgcagagaaaattaagaagtacaat
atccatgcacttctcatgattggcggctttgaggcgtacatgagtgcaatccagatgcta
gaggctcgcaagcaatacccagagctgtgcatcccagtggtcgttatcccggcgactgtc
agtaacaacgtaccagggacagacttcagtctgggatgtgatactgccctcaacgccatc
gctgatatctgtgatcgcatcaagcagtcggccagcgggtccaagaggcgtgtcttcatc
gtggagaccatgggtggatactgcggttacctagcaaccatgagcggcttggccggagga
gccgatgcagcttacatctttgaagaacccttcaccatcagggatctagagcttgatgtg
actcatttggcagccaagatagctgatggtgtacagagaggtctcatcctcaggaatgag
aaggccagcagcaatttcaccaccgaattcctccagcgtctgtactctgaggagggcaag
catctcttcaccaccaggatgaatgttctcggtcacatgcagcagggtggtagtccgact
gtttttgatcgtaatatgggtaccaagcttggagtcaaagcatcaaacttcctccaggaa
aaggtcaaggaattctccaaagatggtggcgtgttcacagactctgatgatactgtatgt
ttgttgggcatctctcagagagtggttggcttcacaccagtcaagttgcttgagaaatac
acagactttgagcatcgcatcccaaagaaccagtggtggatgaaattgcgccctctgttg
aggattcttgccaagcatgtagagatctacgaagccgagacggagggtgtggcccaacca
atagaatag

DBGET integrated database retrieval system