KEGG   Strongylocentrotus purpuratus (purple sea urchin): 548617Help
Entry
548617            CDS       T01019                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:spu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:spu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:spu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:spu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spu00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 842 aa AA seqDB search
MTDPGSPTKRLRQDPIPESSPVHVGGDDVFTSPIREQLMQHSTSASHLQRRQTLSYDMVD
TVGQFSARGEGFNMVGEGKCIAVFTSGGDSQGMNAAVRSVARIGIYVGFKVYAIHEGYQG
MCDGGDHIKELSWSDVSNIIQLGGTVIGSARCKDFRERDGRKKAAMNLIKKGINNLVVIG
GDGSLTGANVFRQEWGNFVAELSKEGKITSEEAKACEYLNVVGMVGSIDNDFCGTDMTIG
TDTALHRILEAVDAISTTASSHQRCFVLEVMGRHCGYLALVAGLASAADWIFIPEMPPDA
GWENKICNKLQQTREFRKRLNIIIVAEGACTQEGDPITANLIKDLIIKRLGFDTRVTVLG
HVQRGGNPSAFDRILGCRMGAEAVLSLVDTKPDMPAYVVSLDGNKAIRVPLMDCVRKTQA
VGEALRAKDFKKACSLRGRSFLSNLSIYLTLSRIKPKEEVCSLDGRLCASNHNLAVMNVG
APAAGMNATVRAFIRTSLFQGYRVYRITDGFEGLIADKVQLSGWMDVSDWVRQGGSLLGT
NRTTPKKDMAAVAEKIKKYNIHALLMIGGFEAYMSAIQMLEARKQYPELCIPVVVIPATV
SNNVPGTDFSLGCDTALNAIADICDRIKQSASGSKRRVFIVETMGGYCGYLATMSGLAGG
ADAAYIFEEPFTIRDLELDVTHLAAKIADGVQRGLILRNEKASSNFTTEFLQRLYSEEGK
HLFTTRMNVLGHMQQGGSPTVFDRNMGTKLGVKASNFLQEKVKEFSKDGGVFTDSDDTVC
LLGISQRVVGFTPVKLLEKYTDFEHRIPKNQWWMKLRPLLRILAKHVEIYEAETEGVAQP
IE
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgacggatccaggctcgccgacgaagcggctacggcaagacccaatacccgagtctagc
ccggtgcacgtgggaggggacgacgtattcacatcgcccatcagagaacagttgatgcag
cacagtacaagtgcatcgcacttacaaagacgtcaaaccttgtcatacgacatggtggat
acagtgggacagttttcagcaagaggagagggctttaatatggtgggagaaggaaaatgc
attgcagtattcacaagtggaggtgattctcaaggtatgaatgcagctgtgagatctgtt
gcacgtatagggatctatgttggattcaaggtctatgcaatacatgagggttaccaaggg
atgtgtgatggaggcgatcatatcaaggagctttcttggtcagatgtttctaatatcatc
cagctgggtggtaccgtgatcgggagtgctcgctgcaaggacttcagggagagggacgga
agaaagaaggctgccatgaacctcatcaagaaaggcatcaacaacctggtggtcatcggg
ggagacggtagcttgactggtgctaacgtcttcagacaagagtggggcaactttgtagca
gaactctccaaagaaggcaagataacttcagaagaggctaaagcttgtgaatacctcaac
gtcgttggcatggtgggttccatcgacaatgatttctgtggtactgacatgaccataggc
acagacactgcactgcacaggatcttagaggcagtggatgcgatcagtactacagcatca
agccatcaacgctgctttgtactggaggtcatgggtcgtcactgtggttacctagccttg
gttgcaggcttggcatccgctgccgattggatcttcatccctgaaatgccaccagatgct
ggctgggaaaataagatctgtaacaaacttcaacagacccgagagttccgcaaacgtctg
aacatcatcatcgtagcagagggtgcctgcacacaggaaggtgatccaatcacagctaac
ctcattaaggatctgattatcaaacgtctagggtttgacaccagagtgactgttcttggt
cacgtccagcgaggcggtaacccatcggcctttgacagaatcctggggtgtaggatgggt
gctgaagcagtactgtctctggtagataccaagcctgacatgccagcctatgtggtatct
ctagacggtaacaaggctatacgggttcctctcatggactgtgttagaaagactcaggcg
gttggtgaggctttgagagcgaaagacttcaagaaggcatgctctctgagaggaaggagt
tttttgagcaatctaagcatttacctgacactatcccgaatcaagcccaaggaggaggtg
tgcagcttggatggtagactttgtgctagcaatcacaacttggctgttatgaacgtcgga
gcacctgcagctggcatgaatgcaactgtgagggcgtttatccgaacgtctctcttccag
ggatatagggtctaccgcatcaccgacgggtttgaagggcttatcgctgacaaggttcag
ctatctggctggatggatgtgagtgattgggtgcgacaaggaggctctctacttggaaca
aacaggacaactccaaagaaggacatggctgctgttgcagagaaaattaagaagtacaat
atccatgcacttctcatgattggcggctttgaggcgtacatgagtgcaatccagatgcta
gaggctcgcaagcaatacccagagctgtgcatcccagtggtcgttatcccggcgactgtc
agtaacaacgtaccagggacagacttcagtctgggatgtgatactgccctcaacgccatc
gctgatatctgtgatcgcatcaagcagtcggccagcgggtccaagaggcgtgtcttcatc
gtggagaccatgggtggatactgcggttacctagcaaccatgagcggcttggccggagga
gccgatgcagcttacatctttgaagaacccttcaccatcagggatctagagcttgatgtg
actcatttggcagccaagatagctgatggtgtacagagaggtctcatcctcaggaatgag
aaggccagcagcaatttcaccaccgaattcctccagcgtctgtactctgaggagggcaag
catctcttcaccaccaggatgaatgttctcggtcacatgcagcagggtggtagtccgact
gtttttgatcgtaatatgggtaccaagcttggagtcaaagcatcaaacttcctccaggaa
aaggtcaaggaattctccaaagatggtggcgtgttcacagactctgatgatactgtatgt
ttgttgggcatctctcagagagtggttggcttcacaccagtcaagttgcttgagaaatac
acagactttgagcatcgcatcccaaagaaccagtggtggatgaaattgcgccctctgttg
aggattcttgccaagcatgtagagatctacgaagccgagacggagggtgtggcccaacca
atagaatag

DBGET integrated database retrieval system