KEGG   Strongylocentrotus purpuratus (purple sea urchin): 574567Help
Entry
574567            CDS       T01019                                 

Definition
(RefSeq) retinoic acid receptor alpha-A
  KO
K08528  
retinoic acid receptor beta
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Transcription factors [BR:spu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    574567
Nuclear receptors [BR:spu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   574567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 613 aa AA seqDB search
MSGKTERKLQGKSAEDKMRVVSSNQLSTEQDDIKPQVSCTPSTSSAVKPTLLLPPSSPSI
STASSPSPSPSTSSLGSPSASSNWAHIKFKIEKKAPRASSSSSSPSSSTASPSPSSSLFH
VFPPPTSPHLGHNLPSGSSSSSSSSSTLPPLSSLPSCSGTARSSSIPTVFATPPTQTAGS
AFHRKAQEELARKPALKELLQPSKMEPNMSMNYNSMHQGAMPPSYSPGYSPYPCMMPQEG
QSASLPTQMQLPNLPHPSPSESPPPPPRVYKPCFVCADKSSGYHYGVSACEGCKGFFRRS
VQKNMQYTCHRDQKCIINKVTRNRCQHCRLKKCFEVGMSKECVRNDRNKKKKKNDEVTES
LVIPTEIEDILQEVLRAHRDTFPQRPLHPIHNADDEEEGVPNHPVSNFKGQDIDMVMFDY
VTDMSSRAIVMVVDFAKKLPGFLSLSTQDQITLLKASCLDIMILRICSRFNPQDASVTFT
TGLTLTQGQLKAGGFGSLLDVIFTFASSLSRMHIDETEIALLSAICLISEDRTGLEDAPR
IEKMQEPLLEGLRLYVRKRRPKESHFFAKLLMKITDLRCISVKSAEKVFDMKVEFVKEMP
ALISEMIDKNDDE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaagacggagaggaaacttcagggcaagtcggcagaagacaagatgcgtgtt
gtgtcatccaaccaattgtcgacggaacaagatgacatcaagccccaagtgtcttgcaca
ccttcaacatcgtcagctgtaaaaccaactttattattaccaccatcgtctccgtcgata
tcaacggcatcttcaccctctccatcgccgtcgacatcgtcgctaggtagcccgtcagca
agcagcaactgggcgcatattaagtttaagatagaaaaaaaggcaccacgcgcatcatca
tcatcatcgtcgccgtcgtcgtctacagcctcgccatcaccatcttcgtcgttgttccac
gtctttccaccgcctacttcaccgcatctagggcacaatctgccaagtgggtcgtcgtcg
tcgtcatcgtcctcatcgacgttgccgccgctctcatcgctgccttcgtgttcaggcacc
gctcgttcgtcaagcattccaacggtgttcgctactcctccgacacaaactgcaggatca
gcgtttcaccgcaaagcacaagaagaactcgctcgcaaaccggctttgaaagagctttta
caacccagtaaaatggagcccaatatgtctatgaactacaacagtatgcatcaaggagca
atgcctccaagttattcaccgggctattcaccttacccctgtatgatgccccaagaaggc
cagtcagcgtccctccctacacagatgcaactgcccaatctcccccatcccagcccttcc
gagtcgcctccgcccccgccgagggtctacaaaccatgctttgtatgcgcggacaagtct
tccggataccactacggggtcagcgcctgcgaaggctgcaagggtttcttccgacgaagc
gtgcagaagaacatgcaatacacatgccaccgcgaccaaaagtgcatcatcaacaaagtg
acgcggaatcgctgccaacactgccggctcaagaagtgttttgaagttggaatgtccaaa
gaatgcgtaaggaacgacaggaataagaagaaaaagaagaatgatgaggtgaccgagagc
ctggtaattcctaccgaaattgaagatatcctccaggaagtgctacgagcccacagggac
accttcccacaaagaccactacacccaatccacaatgcggatgatgaggaggagggggtc
ccaaaccatcccgtcagtaacttcaaggggcaggacattgacatggtcatgttcgactat
gtaactgacatgtcatcacgggccatcgtcatggtggtggacttcgccaagaaactgcct
ggcttcctctcgttgagtacccaagatcagatcactctcctcaaagcctcttgccttgat
atcatgatcctgagaatatgttcccgtttcaaccctcaagatgccagtgtgaccttcacc
actggattgaccctaactcaaggtcaactcaaggctggtggctttggtagtctccttgat
gtgatcttcacctttgcttcatctctctccaggatgcacattgatgagactgaaattgcc
ctattatcagctatctgtctcatcagtgaagaccggactggattggaggatgctccaagg
atagagaagatgcaagagcctctgctagaaggcttaagactctacgtccgcaagcgtcgg
cccaaggagtctcatttcttcgctaagcttctcatgaagatcaccgatctacgctgtatc
agcgtcaagagtgcagagaaggtattcgacatgaaggtggagtttgtaaaggagatgcca
gctctcatctcggagatgatcgacaagaatgacgacgagtag

DBGET integrated database retrieval system