KEGG   Strongylocentrotus purpuratus (purple sea urchin): 574567Help
Entry
574567            CDS       T01019                                 

Definition
retinoic acid receptor beta-like
Orthology
K08528  
retinoic acid receptor beta
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 409 aa AA seqDB search
MEPNMSMNYNSMHQGAMPPSYSPGYSPYPCMMPQEGQSASLPTQMQLPNLPHPSPSESPP
PPPRVYKPCFVCADKSSGYHYGVSACEGCKGFFRRSVQKNMQYTCHRDQKCIINKVTRNR
CQHCRLKKCFEVGMSKECVRNDRNKKKKKNDEVTESLVIPTEIEDILQEVLRAHRDTFPQ
RPLHPIHNADDEEEGVPNHPVSNFKGQDIDMVMFDYVTDMSSRAIVMVVDFAKKLPGFLS
LSTQDQITLLKASCLDIMILRICSRFNPQDASVTFTTGLTLTQGQLKAGGFGSLLDVIFT
FASSLSRMHIDETEIALLSAICLISEDRTGLEDAPRIEKMQEPLLEGLRLYVRKRRPKES
HFFAKLLMKITDLRCISVKSAEKVFDMKVEFVKEMPALISEMIDKNDDE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaatatgtctatgaactacaacagtatgcatcaaggagcaatgcctccaagt
tattcaccgggctattcaccttacccctgtatgatgccccaagaaggccagtcagcgtcc
ctccctacacagatgcaactgcccaatctcccccatcccagcccttccgagtcgcctccg
cccccgccgagggtctacaaaccatgctttgtatgcgcggacaagtcttccggataccac
tacggggtcagcgcctgcgaaggctgcaagggtttcttccgacgaagcgtgcagaagaac
atgcaatacacatgccaccgcgaccaaaagtgcatcatcaacaaagtgacgcggaatcgc
tgccaacactgccggctcaagaagtgttttgaagttggaatgtccaaagaatgcgtaagg
aacgacaggaataagaagaaaaagaagaatgatgaggtgaccgagagcctggtaattcct
accgaaattgaagatatcctccaggaagtgctacgagcccacagggacaccttcccacaa
agaccactacacccaatccacaatgcggatgatgaggaggagggggtcccaaaccatccc
gtcagtaacttcaaggggcaggacattgacatggtcatgttcgactatgtaactgacatg
tcatcacgggccatcgtcatggtggtggacttcgccaagaaactgcctggcttcctctcg
ttgagtacccaagatcagatcactctcctcaaagcctcttgccttgatatcatgatcctg
agaatatgttcccgtttcaaccctcaagatgccagtgtgaccttcaccactggattgacc
ctaactcaaggtcaactcaaggctggtggctttggtagtctccttgatgtgatcttcacc
tttgcttcatctctctccaggatgcacattgatgagactgaaattgccctattatcagct
atctgtctcatcagtgaagaccggactggattggaggatgctccaaggatagagaagatg
caagagcctctgctagaaggcttaagactctacgtccgcaagcgtcggcccaaggagtct
catttcttcgctaagcttctcatgaagatcaccgatctacgctgtatcagcgtcaagagt
gcagagaaggtattcgacatgaaggtggagtttgtaaaggagatgccagctctcatctcg
gagatgatcgacaagaatgacgacgagtag

DBGET integrated database retrieval system