KEGG   Strongylocentrotus purpuratus (purple sea urchin): 574737Help
Entry
574737            CDS       T01019                                 

Gene name
bckdk
Definition
branched chain ketoacid dehydrogenase kinase
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     574737 (bckdk)
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   574737 (bckdk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 418 aa AA seqDB search
MALSTMKANQLVFKQALNFKSASYSRSIAITSYRPQSNYSAVHDYSPAKEKSRPVVSFYN
QSAIDVAAKKPSVRLTPATLLYTGKSPDGNHLLRSAQYLHKELPVRVAHRIAEFRGLPFI
VGCNPTILHVHELYIRAFHLLSEFPSIRDMDTERQYCKMVKTLLDDHKDVVTHLAEGFRE
CRKHITDESLIHNFLDRILTSRLGIRMLAEHHLFLHQDKNDSIGIIATKMSLKKVIEKWV
SFAREQCELRFGYAPSVKINGHTGATFPYIIQPLDYMLPELLKNAMRATIESHLDTPMNL
PDVVITIASNEVDFIIRISDRGGGIPHSLLKKVFQYHFTTANDDESVSDNGGALGTMIEA
VNQPTAGPLCGFGFGLPVSKAYAEYLGGSISLETMQGIGTDVYLRLRHIDGKQESFRI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcattatcaacgatgaaagcaaatcaactagtcttcaagcaggctttaaattttaag
agcgcttcatacagcaggagtattgctattacttcttaccgtccacaaagtaattactca
gctgtccatgattacagcccagcaaaggaaaagtcgaggccagttgtgtccttttacaac
caaagtgcaatcgacgtcgcagcaaaaaagccctctgtacgtttgacaccagccacactc
ctctacactggcaagtcacctgatggcaaccatctattgaggagtgcccagtatctacac
aaggagctccctgtgagggtagcccatcgtattgcggaattccgtggtctacccttcatt
gttggctgcaatcccacaatcctccatgttcacgaactctacatccgagcattccacctt
ctctcagagtttccttcaatccgagacatggatacagagagacagtactgtaagatggtg
aagacgttattagatgaccacaaagatgttgtaactcatctagctgagggcttcagggaa
tgcaggaaacacatcactgacgagagtctaatccacaatttcttggatcgcatcctgacc
tcacggctaggtatccggatgttggcagaacatcatctatttcttcatcaagataagaat
gactctattggtatcatcgcaaccaagatgtcactcaagaaagtgatcgagaagtgggtg
tcatttgcaagagagcaatgtgagttgcggtttggctatgctcccagtgtgaagatcaat
ggacacactggagccactttcccgtacatcatccagcctttagattacatgcttccagaa
ctcctcaagaatgccatgagagccacgattgagagtcatttggatacccctatgaatcta
ccagatgtagtcattaccatcgccagtaatgaagttgatttcatcattaggatatctgat
cgaggaggaggtatcccccattccttgttgaagaaggtgttccagtatcacttcacgacg
gccaatgatgacgagagtgtgagtgataatggtggagcgttgggtaccatgatcgaagcc
gtcaatcagcctacagccggacctctctgtggatttggctttggactgccagtatccaag
gcatatgcagagtacctaggagggtctatatcactggagaccatgcaaggtatcggaaca
gatgtctaccttagactgaggcacattgatggcaaacaggagagctttaggatctaa

DBGET integrated database retrieval system