KEGG   Strongylocentrotus purpuratus (purple sea urchin): 574783Help
Entry
574783            CDS       T01019                                 

Definition
serine/threonine-protein kinase NLK-like
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    574783
   04068 FoxO signaling pathway
    574783
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     574783
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   574783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 442 aa AA seqDB search
MAVCGSRISHSQMAFANGSSSAHDRAILSATQTYYQPSPAASSVPRREFEPDRPIGYGAF
GVVWSVTDPRDGKRVALKKMPHVFQNLISCKRVYRELKMLFFFNHDNVLRALDILQPPHV
DFFEEIYVVTELLQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGN
LLVNSNCVLKVCDFGLARVEEPDTSKHMTQEVVTQYYRAPEILVGSKHYTSAVDMWSVGC
IFAELLGRRILFQAQSPITQLNLITDLLGTPSMEDMKYACDGARAHLLRMPHKPPCLSAL
YGLSSHATHEAVHLLSRMLVFNPDKRISCIDALAHPYLDEGRLRYHTCMCNCCHNTSAGR
QYTGEFEPAAPQRFDCLYEDDLHTVSQVKEALHKFITDRHQGNTVPLCINPQSAAFKSFA
RTGKKVFDVPSDAANLLIPVRQ
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttgcggatctaggatttctcactctcagatggctttcgctaacgggtcctcc
agcgcccacgaccgtgcaatcctgagtgcaactcagacctactatcagccttctcctgcc
gcttcgtctgtgcctagaagagaatttgagcccgatcgtccaatcggttatggggcgttt
ggtgttgtctggtcggtgacggaccctcgcgatggcaagcgggtcgccctcaagaagatg
ccccacgtcttccagaacctcatctcatgcaaaagggtctaccgggaactcaagatgctc
ttcttctttaatcatgacaatgtgcttcgagctctggatatccttcaacccccacatgta
gacttctttgaagaaatatatgttgtaacagagcttctccagagcgacctacacaagatc
atcgtatctccccagccactcagctcagatcatgtcaaggtcttcctctaccagatactc
agagggctcaagtacttgcattcagcgggcatcctacatagggatatcaaaccaggcaat
cttctcgtcaacagtaactgtgtacttaaggtgtgtgactttggtctggcccgagtggag
gagcccgacaccagcaaacacatgacccaggaggtcgtgacccagtactaccgcgcccct
gagatcctggtagggagcaaacactacacctcggccgtggacatgtggtcggtaggctgc
atcttcgcggagctcctcggcagacggatcctcttccaggctcaaagtccaatcacacaa
ctcaatttaatcacagatcttcttgggacgccatctatggaggatatgaagtacgcctgt
gacggagcacgggctcacctcctacgcatgccacataaaccgccttgcctctcagcttta
tatggtctctccagccacgccactcatgaagctgtccacttactcagtagaatgctcgtc
ttcaatccggacaaaaggatttcatgtatcgacgccctcgcgcacccttaccttgacgag
gggcggttacgttaccacacatgcatgtgcaattgctgccacaatacatcggcaggccgg
cagtacaccggcgagtttgaacccgctgcccctcagaggttcgactgtttgtacgaggat
gacctccacacggtatcgcaggtcaaagaagcgctacacaaattcatcaccgacagacat
cagggtaacaccgtacctctatgcatcaacccgcaatcagccgccttcaagagttttgca
aggactgggaaaaaggtttttgatgtaccatcagacgctgccaatttactgattccagtt
cgtcagtag

DBGET integrated database retrieval system