KEGG   Strongylocentrotus purpuratus (purple sea urchin): 574811Help
Entry
574811            CDS       T01019                                 

Definition
ras-specific guanine nucleotide-releasing factor 1-like
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1235 aa AA seqDB search
MQKAIRLDDSQLLMLAGRAKTDFTIAGNLQKKSSDTGKWKQRWCALYENLLFYFENETTS
RPLGLIFVEGCYSEHIVTPRSSVKDEKQIHKQHFWYFSIHYRHDSQRQYDLRCDTEGEVN
AWVDAIKHCNFNAILLQKEELEQKYLHLLQIHDSEKIAKFGLRQQCQELTAEVAKLKTEL
NLLQRRERKMSGSIKGAPEDDEAEDIKKIKRVQSFIRGWLCRRRWKAIVQDYIRSPHAES
MRKRNSIVFGMIEGEREYVEQLSTLVSCFLRPLKMAASAKKPLISHEDVNSIFLNSETIF
FLHQIFYKGLSARMEHWPKLVLGDLFDMLLPMLSIYNEYVRNHHYSLQVLAECKQNPAFN
MLLKQYETKPVCESRSLETFLTYPMHQVPRYIISLHELLAHTPHDHVERKSLEYAKLKLE
ELSRVMHDEVSETESIRRNLSIERMIVEGCDLLLDVQQMFVRQGNLIQVTHERSRQSRSR
LGSLGGKVESRKEGVRQCFLFTKHLLITSRTSGGKLHLAKVGKIPLIDSTIVEDFDPFDD
DGDDHDNLDFKLIVDSKSGPPLVITLVASTPQEKAAWTSDISQCIDNLHYNGLLDSSLED
SGSSVHLPQCIKSDTRLFKDDHDIRFSKILNSCKVPQIRYASLERLLERLTDLRFLSIDF
LNTFLLTFRVFTDWETIVSTLERVYRNPDTVEGQLNVHPHPPPSPSHHGDPHHSHGNQYE
NSPPPASPSRGFINRRPSTSNHPGAGANIKVTMTKPYHEEMETDGGSSGGSGGRLETLRL
HPKRMLSMSHSAPNIAALVKAAKPDPIPIPPTSPHRSPAGNNFFQFSSSPPNTTVSAGVV
VTSSRMSTRRSSCSSAAVAFAAATAGATNAKEFGGPNNMLSRKRAKKSYGRNKEVISSAA
TVRVINVIRHWVSKFSKNFEINEGLRNRVLEFLEEVATNPNLLPSEHRAASTIQRXILQQ
IMQDHANISLHGEAEFASLVPEQPLPEDTFDRMSALELAEQLSYLEHKLLRAIPYWEFLN
QAWMKQGKATRAPNILAVTRRFNEVSKLVSSEILRQKSVAARALAIERWAGVADICRCMH
NFNSVLEITSALMNSSVYRLKKVWEKVPKQTKTLLDKLQVLVSSDGRFKNMRDALHRIDP
PCVPYLGFYLTDLAFIEDGTPNITDDRLINFSKMRMIAHVVREIRHFQHTNYNIEPDKRV
ISYLLDTSLIMDDDEMYALSLELEPRQSTRMAKSI
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagcaatccgtctcgatgactctcagcttctgatgctagctggtcgtgctaag
actgacttcaccatcgcaggcaatctacagaagaagagttctgatacaggcaagtggaaa
cagcgctggtgtgctctctatgaaaacctgctcttctactttgagaatgagacgaccagt
cgacccttggggctcatctttgtggaggggtgctactcggaacatattgtgaccccaaga
agcagtgtcaaagatgagaaacagattcataaacaacatttctggtacttttctattcac
taccgtcatgatagtcagaggcagtatgatctacgctgtgatacagagggtgaagtcaat
gcatgggttgatgctatcaaacactgcaacttcaatgccattctgctccaaaaggaggaa
ctggagcagaagtatcttcatcttctacagatccatgatagtgagaagatagcaaagttt
ggtcttcgtcagcaatgccaggaactcacagcagaagtggccaaactcaaaacagaacta
aacctgttgcaaaggagagaaaggaagatgtctggttcaataaaaggagctccggaagat
gatgaggctgaggatatcaaaaagatcaagagagtgcaaagcttcatacgaggctggctg
tgccgacgccgctggaaggccatcgttcaggactacattagatctccacatgcagagagc
atgcgcaagcgcaacagtattgtcttcggtatgatagaaggtgaacgagagtatgttgag
caactttccacgcttgtctcgtgctttctgcgccctctcaagatggctgccagtgccaag
aaaccactcatttcccatgaggacgtcaactcaatctttctcaacagtgaaacaatattc
ttcttgcatcaaatcttctacaagggactaagcgccaggatggaacactggcccaaattg
gtccttggtgatttgtttgatatgctgcttcctatgctgagtatctacaatgagtatgtg
aggaatcatcattacagtctacaggtgttagctgaatgcaagcagaatcctgcctttaat
atgctactcaaacaatatgagactaaaccagtttgtgaatcaaggtctctggagacattc
ctgacctaccctatgcatcaggtgcccaggtacattatctcactacatgagctgctagca
cacacacctcatgaccatgtggagaggaagagcttggagtatgccaaacttaaactggaa
gagttatctagggtaatgcatgatgaggtatctgagacagagagcatccgacggaacctg
tcgattgagaggatgatagtagaaggatgtgatcttcttcttgatgtccagcagatgttt
gttagacaaggtaacttaatccaggtaacccatgagagatcaagacagagtagaagcaga
ttggggtccctaggaggcaaggtggagagtcggaaagagggtgtcaggcagtgtttcctc
ttcactaaacatctacttattacctctaggacatcaggtggaaagctacatctggccaag
gtgggcaagattcctctgattgattcaactattgttgaagactttgatccctttgatgat
gatggtgatgatcatgataacctagacttcaagctcatagttgactcaaagagtggacca
cccctcgtcatcacattggtagcatctacaccacaggagaaagctgcttggactagtgat
atcagtcagtgcattgacaacttacattacaatggtctgctcgacagctcattagaggat
agtggatcttctgttcatctccctcagtgtatcaaatcggacactcgtctcttcaaggat
gaccatgacatccggttcagtaagattctcaactcctgcaaggtacctcagatccgttat
gccagcctagagagacttctggagcggttgacagaccttcgcttcctcagtatagacttt
ctcaataccttcttactaacattcagggtattcacagactgggagaccatagtctctaca
ctggagagggtctacaggaatccagatacagtggagggtcagttgaatgtacatccacat
cctcctccatcccctagtcaccatggtgacccacatcactcccatggtaatcagtatgag
aacagccctcctccggctagtccttccagaggattcatcaatcgtcgacccagtaccagc
aaccaccctggagcaggagctaacatcaaggtgacaatgaccaaaccatatcatgaggag
atggagactgatggaggaagtagtggtggtagtggagggagactagagacccttcgtcta
catcctaagagaatgctatctatgagtcattcagctccaaacattgctgctctagtcaag
gcagctaaaccagatcccatccccattcctccaacatcaccccaccgatcacctgctggc
aataacttcttccagtttagcagttctccccctaacaccactgtctcagccggtgtagtg
gtcacctcctcccgtatgtctacccgcaggtcaagctgctcttccgctgcagtggccttt
gccgctgcaacggccggcgccaccaatgcaaaggaatttggtgggcccaacaacatgctg
agtcggaagagggcaaagaaaagctacggacgtaataaagaagtcatcagttcagctgct
accgtcagagttatcaatgtcatcagacattgggtctctaagttctctaagaattttgaa
atcaatgaaggcttacgcaatcgggttttagaattcttggaagaagtagcaaccaatccc
aaccttctcccatcagaacacagagcagctagcaccattcagaggtagatattacagcaa
attatgcaggatcatgcaaacatcagtttacatggtgaagcagagttcgcctccttggtt
cctgaacagccgttgcctgaggacacctttgacaggatgtcagcattggagctggcagaa
caactcagctacctagaacataaactactcagggctatcccatattgggaatttcttaat
caggcttggatgaagcagggtaaagcaacgagggcgccaaatatccttgcagtcactagg
agattcaatgaggttagcaagttggtatcatctgaaatcttacgtcagaagtctgtagca
gccagagcgttagccatagagagatgggctggtgttgctgatatctgcaggtgtatgcat
aacttcaacagtgtactagagatcacttcagccctcatgaacagctcagtctacagactc
aagaaagtctgggaaaaggttcctaagcaaacgaagactcttctagacaaacttcaggtg
ttagtatcttcagatggcaggttcaagaacatgagagatgccttacatagaattgatcct
ccttgtgtgccctaccttggtttctacctgactgaccttgccttcatagaggatggcact
ccaaacatcactgatgatagactgatcaacttctccaagatgagaatgattgctcatgtg
gttcgagaaatcaggcatttccagcataccaactacaacatagaaccagacaaaagggtg
ataagctacctcttggacacgtctttgatcatggatgatgacgagatgtatgccttgtct
ctggaacttgaaccacgacagtctacaaggatggctaaaagcatatga

DBGET integrated database retrieval system