KEGG   Strongylocentrotus purpuratus (purple sea urchin): 574811Help
Entry
574811            CDS       T01019                                 

Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 2-like
  KO
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1341 aa AA seqDB search
MQKAIRLDDSQLLMLAGRAKTDFTIAGNLQKKSSDTGKWKQRWCALYENLLFYFENETTS
RPLGLIFVEGCYSEHIVTPRSSVKDEKQFWYFSIHYRHDSQRQYDLRCDTEGEVNAWVDA
IKHCNFNAILLQKEELEQKYLHLLQIHDSEKIAKFGLRQQCQELTAEVAKLKTELNLLQR
RERKMSGSIKGAPEDDEAEDIKKIKRVQSFIRGWLCRRRWKAIVQDYIRSPHAESMRKRN
SIVFGMIEGEREYVEQLSTLVSCFLRPLKMAASAKKPLISHEDVNSIFLNSETIFFLHQI
FYKGLSARMEHWPKLVLGDLFDMLLPMLSIYNEYVRNHHYSLQVLAECKQNPAFNMLLKQ
YETKPVCESRSLETFLTYPMHQVPRYIISLHELLAHTPHDHVERKSLEYAKLKLEELSRV
MHDEVSETESIRRNLSIERMIVEGCDLLLDVQQMFVRQGNLIQVTHERSRQSRSRLGSLG
GKVESRKEGVRQCFLFTKHLLITSRTSGGKLHLAKVGGKIPLIDSTIVEDFDPFDDDGVP
SPSNQSSDHDNLDFKLIVDSKSGPPLVITLVASTPQEKAAWTSDISQCIDNLHYNGLLDS
SLEDSGSSVHLPQCINMWKVCSSMVSCLCATPYRSDTRLFKDDHDIRFSKILNSCKVPQI
RYASLERLLERLTDLRFLSIDFLNTFLLTFRVFTDWETIVSTLERVYRNPDTVEGQLNVH
PHPPPSPSHHGDPHHSHGNQYENSPPPASPSRGFINRRPSTSNHPGAGANIKVTMTKPYH
EEMETDGGSSGGSGGRVFEANTTLRAHPFRRSFKKVADDTQSKTDSSVPMSIADPHVSPP
DSPPYFHTLTPPAPPNQLETLRLHPKRMLSMSHSAPNIAALVKAAKPDPIPIPPTSPHRS
PAGNNFFQFSSSPPNTTVSAGVVVTSSRMSTRRSSCSSAAVAFAAATAGATNAKEFGGPN
NMLSRKRAKKSYGRKLGIFLYDMEFTFDETRSNSGKLQSCLSKEVISSAATVRVINVIRH
WVSKFSKNFEINEGLRNRVLEFLEEVATNPNLLPSEHRAASTIQRQIMQDHANISLHGEA
EFASLVPEQPLPEDTFDRMSALELAEQLSYLEHKLLRAIPYWEFLNQAWMKQGKATRAPN
ILAVTRRFNEVSKLVSSEILRQKSVAARALAIERWAGVADICRCMHNFNSVLEITSALMN
SSVYRLKKVWEKVPKQTKTLLDKLQVLVSSDGRFKNMRDALHRIDPPCVPYLGFYLTDLA
FIEDGTPNITDDRLINFSKMRMIAHVVREIRHFQHTNYNIEPDKRVISYLLDTSLIMDDD
EMYALSLELEPRQSTRMAKSI
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagcaatccgtctcgatgactctcagcttctgatgctagctggtcgtgctaag
actgacttcaccatcgcaggcaatctacagaagaagagttctgatacaggcaagtggaaa
cagcgctggtgtgctctctatgaaaacctgctcttctactttgagaatgagacgaccagt
cgacccttggggctcatctttgtggaggggtgctactcggaacatattgtgaccccaaga
agcagtgtcaaagatgagaaacagttctggtacttttctattcactaccgtcatgatagt
cagaggcagtatgatctacgctgtgatacagagggtgaagtcaatgcatgggttgatgct
atcaaacactgcaacttcaatgccattctgctccaaaaggaggaactggagcagaagtat
cttcatcttctacagatccatgatagtgagaagatagcaaagtttggtcttcgtcagcaa
tgccaggaactcacagcagaagtggccaaactcaaaacagaactaaacctgttgcaaagg
agagaaaggaagatgtctggttcaataaaaggagctccggaagatgatgaggctgaggat
atcaaaaagatcaagagagtgcaaagcttcatacgaggctggctgtgccgacgccgctgg
aaggccatcgttcaggactacattagatctccacatgcagagagcatgcgcaagcgcaac
agtattgtcttcggtatgatagaaggtgaacgagagtatgttgagcaactttccacgctt
gtctcgtgctttctgcgccctctcaagatggctgccagtgccaagaaaccactcatttcc
catgaggacgtcaactcaatctttctcaacagtgaaacaatattcttcttgcatcaaatc
ttctacaagggactaagcgccaggatggaacactggcccaaattggtccttggtgatttg
tttgatatgctgcttcctatgctgagtatctacaatgagtatgtgaggaatcatcattac
agtctacaggtgttagctgaatgcaagcagaatcctgcctttaatatgctactcaaacaa
tatgagactaaaccagtttgtgaatcaaggtctctggagacattcctgacctaccctatg
catcaggtgcccaggtacattatctcactacatgagctgctagcacacacacctcatgac
catgtggagaggaagagcttggagtatgccaaacttaaactggaagagttatctagggta
atgcatgatgaggtatctgagacagagagcatccgacggaacctgtcgattgagaggatg
atagtagaaggatgtgatcttcttcttgatgtccagcagatgtttgttagacaaggtaac
ttaatccaggtaacccatgagagatcaagacagagtagaagcagattggggtccctagga
ggcaaggtggagagtcggaaagagggtgtcaggcagtgtttcctcttcactaaacatcta
cttattacctctaggacatcaggtggaaagctacatctggccaaggttggaggcaagatt
cctctgattgattcaactattgttgaagactttgatccctttgatgatgatggtgtacca
tcaccctctaatcagagtagtgatcatgataacctagacttcaagctcatagttgactca
aagagtggaccacccctcgtcatcacattggtagcatctacaccacaggagaaagctgct
tggactagtgatatcagtcagtgcattgacaacttacattacaatggtctgctcgacagc
tcattagaggatagtggatcttctgttcatctccctcagtgtatcaatatgtggaaagta
tgttcaagcatggttagctgtttatgcgctacaccatatagatcggacactcgtctcttc
aaggatgaccatgacatccggttcagtaagattctcaactcctgcaaggtacctcagatc
cgttatgccagcctagagagacttctggagcggttgacagaccttcgcttcctcagtata
gactttctcaataccttcttactaacattcagggtattcacagactgggagaccatagtc
tctacactggagagggtctacaggaatccagatacagtggagggtcagttgaatgtacat
ccacatcctcctccatcccctagtcaccatggtgacccacatcactcccatggtaatcag
tatgagaacagccctcctccggctagtccttccagaggattcatcaatcgtcgacccagt
accagcaaccaccctggagcaggagctaacatcaaggtgacaatgaccaaaccatatcat
gaggagatggagactgatggaggaagtagtggtggtagtggagggagagtctttgaggct
aatacaactctcagagcacatccattcaggagaagcttcaagaaagtggctgatgacact
caaagcaagacggatagttcagtgcctatgagcatagcagatcctcatgtctctcctccg
gactctccgccttattttcatacccttacacctcctgctccccctaatcagctagagacc
cttcgtctacatcctaagagaatgctatctatgagtcattcagctccaaacattgctgct
ctagtcaaggcagctaaaccagatcccatccccattcctccaacatcaccccaccgatca
cctgctggcaataacttcttccagtttagcagttctccccctaacaccactgtctcagcc
ggtgtagtggtcacctcctcccgtatgtctacccgcaggtcaagctgctcttccgctgca
gtggcctttgccgctgcaacggccggcgccaccaatgcaaaggaatttggtgggcccaac
aacatgctgagtcggaagagggcaaagaaaagctacggacgtaagctgggaatatttctt
tacgatatggaatttacatttgatgaaacaaggtcaaacagtggtaagcttcagagttgc
ttgagtaaagaagtcatcagttcagctgctaccgtcagagttatcaatgtcatcagacat
tgggtctctaagttctctaagaattttgaaatcaatgaaggcttacgcaatcgggtttta
gaattcttggaagaagtagcaaccaatcccaaccttctcccatcagaacacagagcagct
agcaccattcagaggcaaattatgcaggatcatgcaaacatcagtttacatggtgaagca
gagttcgcctccttggttcctgaacagccgttgcctgaggacacctttgacaggatgtca
gcattggagctggcagaacaactcagctacctagaacataaactactcagggctatccca
tattgggaatttcttaatcaggcttggatgaagcagggtaaagcaacgagggcgccaaat
atccttgcagtcactaggagattcaatgaggttagcaagttggtatcatctgaaatctta
cgtcagaagtctgtagcagccagagcgttagccatagagagatgggctggtgttgctgat
atctgcaggtgtatgcataacttcaacagtgtactagagatcacttcagccctcatgaac
agctcagtctacagactcaagaaagtctgggaaaaggttcctaagcaaacgaagactctt
ctagacaaacttcaggtgttagtatcttcagatggcaggttcaagaacatgagagatgcc
ttacatagaattgatcctccttgtgtgccctaccttggtttctacctgactgaccttgcc
ttcatagaggatggcactccaaacatcactgatgatagactgatcaacttctccaagatg
agaatgattgctcatgtggttcgagaaatcaggcatttccagcataccaactacaacata
gaaccagacaaaagggtgataagctacctcttggacacgtctttgatcatggatgatgac
gagatgtatgccttgtctctggaacttgaaccacgacagtctacaaggatggctaaaagc
atatga

DBGET integrated database retrieval system