KEGG   Strongylocentrotus purpuratus (purple sea urchin): 575335Help
Entry
575335            CDS       T01019                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    575335
   00670 One carbon pool by folate
    575335
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     575335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 189 aa AA seqDB search
MAEKKLNLIAAACTSKGKMGIGINGNLPWRLRQEMAYFERLTKTAQMEGMKNAVIMGRKT
WDSIPEKFRPLKDRVNVVLSNSLTECPPGADHLCSSLNEAVKLFSSPPLSETVDMVWITG
GSAVYKDGIDSPHCHRIYLTRIMKEIECDTFFPEFDLDRFKLVTDPAVDQDTQEEKGIQY
KFEIYESSS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagaaactgaatctaatagctgctgcatgcaccagcaagggtaaaatggga
attggaatcaatggaaacttgccatggagacttcggcaggagatggcgtactttgaaagg
ttaactaagaccgctcagatggaaggaatgaagaatgctgttatcatgggaaggaagaca
tgggactcaataccagaaaaatttagacccctgaaggacagagtcaatgtcgttctcagc
aactctctgacggaatgtccacccggtgcagatcatctatgttcatctttaaatgaagct
gtgaagctgttttcctcacctcctctttcggagacggttgatatggtgtggataacagga
ggtagtgcagtctacaaggatggaatcgactctcctcactgtcatcggatttatctcaca
cgaatcatgaaggagatagagtgcgacacattcttcccagaattcgacctcgacagattc
aaactagtcacagatcctgcagtcgaccaagacactcaagaagaaaaaggcatccagtac
aaatttgagatctatgaaagttcctcctag

DBGET integrated database retrieval system