KEGG   Strongylocentrotus purpuratus (purple sea urchin): 575347Help
Entry
575347            CDS       T01019                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:spu00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 122 aa AA seqDB search
MGKEPKATTPSVGDPDKGAKIFKVKCTQCHVIDNSGKHKQGPNLMGLWGRKTGSAEGFKY
TEANKNKGITWGLDTLWVYLENPKAYIPGTKMVFAGLKKTKERADLIAYLKEKTTGNYTK
DD
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggaaccgaaggctaccactccatcagttggagaccccgacaagggcgccaag
atcttcaaggtcaaatgcacccaatgtcacgttatcgacaacagtggcaagcacaagcaa
ggacccaacctgatgggactgtggggcaggaaaactggctcggctgaaggattcaagtac
acagaagccaacaagaacaaaggtatcacatggggtctggacacgttatgggtctacctg
gagaatcccaaggcatatatcccaggcaccaagatggtcttcgctggcctcaagaagacc
aaggaacgagctgacctcatcgcttacttaaaggagaaaacaacgggaaactacaccaaa
gatgattaa

DBGET integrated database retrieval system