KEGG   Strongylocentrotus purpuratus (purple sea urchin): 575773Help
Entry
575773            CDS       T01019                                 

Gene name
eif4e2
Definition
eukaryotic translation initiation factor 4E member 2
Orthology
K03259  
translation initiation factor 4E
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    575773 (eif4e2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    575773 (eif4e2)
Translation factors [BR:spu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    575773 (eif4e2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 227 aa AA seqDB search
MTVQLKDDDSGEEREEVQIEPSLNKDDIEDPHQIEWPTVKCKQGEHQLQYSYCVWFSRRT
PGNKASSANYEQNIKIIGSFASVEQFWTLYSHIARPCDLTSSSDYHLFKHGIKPMWEDEA
NKKGGKWIVRLRKGLASRLWENLVIAMLGEQFMVGEEICGAVVSVRFAEDIISIWNRTAS
DNSINIRVRDTLQRVLNLPPNTIMEYKTHTDSLKDRSSFRNTDVFMR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgcagttgaaagatgacgacagtggagaagaacgagaggaagtacaaatagaa
ccgtcgctaaacaaggatgacattgaagacccacatcaaatagaatggcccacagtgaaa
tgcaaacagggcgagcatcagcttcagtattcatactgcgtctggttttcaagacgtact
ccaggcaacaaagcatcatcagcaaactatgaacagaacatcaaaataattggctcattt
gcttcagtagaacaattctggaccttgtacagccatatagcaaggccatgtgatctcaca
agtagtagtgactatcatcttttcaaacatggaatcaaacccatgtgggaggatgaagcg
aacaagaaaggcgggaaatggattgttcggctacggaaggggctagcttcacgtctctgg
gagaatctagttattgccatgcttggagaacagttcatggtcggagaggagatatgtggt
gctgtcgtgtcggttagattcgccgaggacatcatctcaatatggaatcgcacagccagc
gacaacagtatcaacattagagtacgagacacattacaaagagtgttaaaccttccgcca
aacaccatcatggaatataagacacacacagatagtttgaaggatagatctagctttagg
aataccgatgtcttcatgaggtag

DBGET integrated database retrieval system