KEGG   Strongylocentrotus purpuratus (purple sea urchin): 575773Help
Entry
575773            CDS       T01019                                 

Gene name
eif4e2
Definition
(RefSeq) eukaryotic translation initiation factor 4E member 2
  KO
K03259  
translation initiation factor 4E
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    575773 (eif4e2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    575773 (eif4e2)
Messenger RNA biogenesis [BR:spu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     575773 (eif4e2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     575773 (eif4e2)
Translation factors [BR:spu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    575773 (eif4e2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 227 aa AA seqDB search
MTVQLKDDDSGEEREEVQIEPSLNKDDIEDPHQIEWPTVKCKQGEHQLQYSYCVWFSRRT
PGNKASSANYEQNIKIIGSFASVEQFWTLYSHIARPCDLTSSSDYHLFKHGIKPMWEDEA
NKKGGKWIVRLRKGLASRLWENLVIAMLGEQFMVGEEICGAVVSVRFAEDIISIWNRTAS
DNSINIRVRDTLQRVLNLPPNTIMEYKTHTDSLKDRSSFRNTDVFMR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgcagttgaaagatgacgacagtggagaagaacgagaggaagtacaaatagaa
ccgtcgctaaacaaggatgacattgaagacccacatcaaatagaatggcccacagtgaaa
tgcaaacagggcgagcatcagcttcagtattcatactgcgtctggttttcaagacgtact
ccaggcaacaaagcatcatcagcaaactatgaacagaacatcaaaataattggctcattt
gcttcagtagaacaattctggaccttgtacagccatatagcaaggccatgtgatctcaca
agtagtagtgactatcatcttttcaaacatggaatcaaacccatgtgggaggatgaagcg
aacaagaaaggcgggaaatggattgttcggctacggaaggggctagcttcacgtctctgg
gagaatctagttattgccatgcttggagaacagttcatggtcggagaggagatatgtggt
gctgtcgtgtcggttagattcgccgaggacatcatctcaatatggaatcgcacagccagc
gacaacagtatcaacattagagtacgagacacattacaaagagtgttaaaccttccgcca
aacaccatcatggaatataagacacacacagatagtttgaaggatagatctagctttagg
aataccgatgtcttcatgaggtag

DBGET integrated database retrieval system