KEGG   Strongylocentrotus purpuratus (purple sea urchin): 575773Help
Entry
575773            CDS       T01019                                 

Gene name
eif4e2
Definition
eukaryotic translation initiation factor 4E member 2
Orthology
K03259  
translation initiation factor 4E
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:spu03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:spu04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 227 aa AA seqDB search
MTVQLKDDDSGEEREEVQIEPSLNKDDIEDPHQIEWPTVKCKQGEHQLQYSYCVWFSRRT
PGNKASSANYEQNIKIIGSFASVEQFWTLYSHIARPCDLTSSSDYHLFKHGIKPMWEDEA
NKKGGKWIVRLRKGLASRLWENLVIAMLGEQFMVGEEICGAVVSVRFAEDIISIWNRTAS
DNSINIRVRDTLQRVLNLPPNTIMEYKTHTDSLKDRSSFRNTDVFMR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgcagttgaaagatgacgacagtggagaagaacgagaggaagtacaaatagaa
ccgtcgctaaacaaggatgacattgaagacccacatcaaatagaatggcccacagtgaaa
tgcaaacagggcgagcatcagcttcagtattcatactgcgtctggttttcaagacgtact
ccaggcaacaaagcatcatcagcaaactatgaacagaacatcaaaataattggctcattt
gcttcagtagaacaattctggaccttgtacagccatatagcaaggccatgtgatctcaca
agtagtagtgactatcatcttttcaaacatggaatcaaacccatgtgggaggatgaagcg
aacaagaaaggcgggaaatggattgttcggctacggaaggggctagcttcacgtctctgg
gagaatctagttattgccatgcttggagaacagttcatggtcggagaggagatatgtggt
gctgtcgtgtcggttagattcgccgaggacatcatctcaatatggaatcgcacagccagc
gacaacagtatcaacattagagtacgagacacattacaaagagtgttaaaccttccgcca
aacaccatcatggaatataagacacacacagatagtttgaaggatagatctagctttagg
aataccgatgtcttcatgaggtag

DBGET integrated database retrieval system