KEGG   Strongylocentrotus purpuratus (purple sea urchin): 575946Help
Entry
575946            CDS       T01019                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    575946
Enzymes [BR:spu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     575946
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C44
   575946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 504 aa AA seqDB search
MQTLMCKKNIHIFTQLSEAFGFPIASKMDGEILLHLYIRGGIEYAASMADGVFAMCIVDT
ASKQVHIGRDTYGVRPMFSLLNEDGFMAISSEAKGLLGLRHGCDDRDVTIKPFPPGHVQS
FNLLPSGKVSPLELIQFHSFEQTPKWSSVEGSLQVEGSLTPTDEDIYANIRALFTEAVRK
RLMGERRIGCMLSGGLDSSLVSSLVMKAMVKDGFDYPLQTFSIGMKGSPDVVAARKVASH
IGSEHHEIGFTPEEGIEAVEHVIKSLESYDITTLRASVGMYLVAQYIRKETDTIVVYSGE
GADCLAQGYIYFHKQPDASAGDDESRKLLKDLYLYDVLRADRTTAAHGLELRCPFLDHHF
TSYFLSLPKEMRCPNKGIEKYLLRKAFDGTGLLPSEILWRPKEAFSDGVSPVEKSWYEFL
QEHIETKVTNDQLADSPKRFPFNPPPSKEAYYYRQVFEKYYPGRSDWIPHIWMPKWTGAT
DPSARTLKHYKESEVSEKQDMEVK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcagacattgatgtgcaaaaaaaatatccatattttcacacagctgagcgaggccttt
ggtttcccgatagcaagcaagatggatggtgagattctgcttcacctttacatcaggggt
ggtatagagtacgcagcatctatggccgacggtgtgttcgctatgtgtatcgttgataca
gctagtaaacaggttcatattggtcgtgatacatacggggtgaggcctatgttctctctt
ctcaacgaggacggctttatggctatcagctcagaggctaaaggtcttcttggtttgagg
catggctgtgatgacagggatgtgaccattaagcctttccctcctggtcatgttcagagc
ttcaacctcctacctagcggcaaggtatcccctctggaactcatccagttccactccttc
gagcagactccaaagtggtcttccgttgagggcagtcttcaagtagagggcagtctcaca
cctacagatgaggacatttatgccaacatccgtgctctctttactgaagcagtgaggaag
cgattgatgggtgagcgtcgtattggatgcatgttgtcaggtggtttggattccagcctg
gtatcatcccttgtcatgaaggcgatggtcaaggatggctttgactatcctcttcagacc
ttctcaatcggaatgaaaggcagtcctgatgtcgttgcagccagaaaggtggcctctcac
atcggcagtgaacatcacgaaattggattcacaccagaagagggcatcgaagcggttgaa
catgtgataaaatctttagagagttatgacatcacaactcttcgagcctcagtcggcatg
tacctcgtagctcaatacatccgtaaggagacggacaccatcgtcgtctactccggtgag
ggtgctgattgtctcgctcagggatacatctatttccacaagcaacccgatgcgtcggct
ggtgatgatgagagcaggaagctgctcaaggatctctacctctatgatgtactccgtgca
gacaggactactgctgctcatggacttgagcttcgttgtccattcctcgatcaccacttc
acctcctacttcctgtccttgccgaaggagatgcgctgtccaaacaaaggcatcgagaaa
tacctgttgcgcaaggcctttgatggaaccggtcttttaccgtctgagatcttatggaga
cccaaagaagctttcagcgacggagtctcgcccgtcgagaagtcgtggtacgagttcctg
caggagcatattgaaacaaaggtgaccaacgaccaacttgcagactctcccaaacgcttc
cccttcaaccctcctccatccaaggaagcatactactacagacaggtctttgagaaatac
taccctggacggtctgactggataccccatatatggatgcctaagtggaccggggcgacc
gacccttcagccaggactctcaaacattataaggagtcagaggtcagtgagaaacaggac
atggaggtcaagtag

DBGET integrated database retrieval system