KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576066Help
Entry
576066            CDS       T01019                                 

Definition
dual specificity mitogen-activated protein kinase kinase 1-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:spu04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:spu04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 425 aa AA seqDB search
MSKTPGKNKNLLNLTIMPIQSESNGGGQKAQSATTATEKSTSGIKVDALTKKLDNLDLDE
PQRKRLEEFMVDKRKIMEIGEFCNDDFEVLKELGAGNGGVVTKVKHKMSGMVMARKLIKL
EIKPAIRNQIIRELKVLHECNSPYIVGFFGAYYSDGEICICMENMDGGSLDQVMKSAPKG
RIPENILGKVTVAVLRGLIYLRDVHDIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSM
ANSFVGTRSYMSPERLQGTHYTVQSDIWSLGLSLVEMAIGRYPIPAPDETALANLFGYEL
QAGETKNIRKTSQSGPRGTPRPISGVGGVFSDSPRPMAIFELLNYIVEEHPPRLPSRAFS
EEFVDFVDVCLIKNPNERADLKKLKVHTFAIMSEEARVDFAGWICATMGMSPPHNDTVKP
LQTAV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagacgcccggaaagaacaaaaatttattgaacttgacaataatgccaatacaa
tcggaatcaaatggcggaggacagaaagcacaatctgcaactacagcgacagagaaaagc
acctctggaattaaagtggatgcactgacaaagaaactggacaatctagatcttgatgaa
ccccaaaggaaacgtcttgaagaatttatggtggacaagaggaagatcatggaaattgga
gaattctgcaatgatgactttgaagtgcttaaggaattaggagcggggaatggaggcgtg
gtcactaaagtgaaacataagatgagcggtatggtaatggcaagaaagctcattaaactt
gaaatcaaaccagccatcagaaatcagatcatccgagaactgaaagtgcttcatgagtgc
aattcaccatacatcgtgggtttctttggagcgtattacagcgatggagagatttgtatc
tgcatggaaaacatggatggcggttctttagatcaagtcatgaagtcagcacccaaggga
agaataccagaaaatatccttggcaaggtcacagttgcagttttgagggggctcatttat
ttaagagatgtgcatgacataatgcacagagatgtgaaaccatcaaatatcctggtcaac
tcacggggagagatcaagttgtgtgattttggtgtgagcggtcagcttatcgactctatg
gcaaattcgtttgtgggaacaaggtcatatatgtcgcctgagagactgcaaggcacacac
tacacagtacagtctgacatctggagtcttggcctatcgctggtcgagatggccattgga
cgttaccccatccccgcccctgacgagacggcgctagcaaacctcttcggctacgagctc
caggcgggagagaccaagaatatccggaaaacaagtcagtcgggacctcgcggtactcca
agaccgatcagtggagttggaggagtgttttcagattccccaagacctatggccatcttt
gaattactcaattatattgtagaagagcatccaccaagattaccatccagagccttctca
gaagaatttgtagattttgttgacgtatgtttgatcaagaatccaaatgagagggcagat
cttaagaaactcaaggtacatacatttgcaataatgtctgaggaagcgagagtagacttt
gctggatggatttgtgcaaccatggggatgagtcctccccataacgacacggtcaaaccc
ctacagacagctgtctag

DBGET integrated database retrieval system