KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576076Help
Entry
576076            CDS       T01019                                 

Gene name
nup205
Definition
(RefSeq) nuclear pore complex protein Nup205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    576076 (nup205)
Messenger RNA biogenesis [BR:spu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     576076 (nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2133 aa AA seqDB search
MAERMAVNLGSRIWGPYKELYHTVSLIVSKRCPDPYQELDALIRKHKPDFVALLKNPAKN
AQHREQIKKADVEGVVISGQARSRVLPRQLIEEALLISDLFDLNEYAAVELLLAGDQQQP
HFPGLPRGLVAVLLYYDGRCSLINALQLLIQSRRGRTWTFDLDKEVVDLVTSFTDDLVSE
GLVGKVLQFLKKMDIVKEMNDMAKERALGGPKHRHDIQEFMRGVRISLADCLYCFACQTP
FGRKDTILLAKHLMSGIELNADGTFDESSVALLMAFLYSIDTGVVEQRPEDRDENEQHLP
ILKDKQYLPKIHDLMISEDEGQWKVKGVKGVMQLAWALTLRNSAQLPELSGFQNEIEDDE
ILVDRAMQADAFSFINKCVIANKVFHQNEFYVRRIHGLITDFIFQMPLKVKEIRNRGDEA
GRLIMSYEREGLEVNSNLPRHFEDFLHLFGYLYEKDPLQLELSLDYWNPPERGSSPGGGG
GASYLSMYHHKQSQRQVSLFKFVRMAGDLLPPSLYIPYLHMLQGLAHGPQSAHHCFNLLK
ANGMGGAGASMGSVSWDHFFLSLNRYYSSLRQEIRSTSPFQEVGHTAQSFRLGAKGITPQ
EMEGLNNVLRLIQVVAKENEDARRAMVENQSWLPSVLLFGLLTCSIPPPLKAECLRNPGG
FAQSPEIAGTLWQSLEVSQIIPTIHQAGVPPSGILLELEEIESNNEEFPLTRGFLAMVDT
LTEIPVPPMLGVGYRPPGFDPYLKFLRDSVFLKFRSRAYRNPAEKWEVAAAVTKILSKLL
AAHEPHAEEFLDHVVELQGGGTAITNKPPGHHLLVHMLNDSSMLQLILSILDESTRLLSQ
YHAFPGKESMTECALYCLTMLDLALEKQDRFIDLLRGQGSSQMVTPLDQLLMGINPRSGR
ADHLCHIAKFVSFNVSLPKHALAAVKVLYRMVKSSNVQPEIVNLFSINKEESGGILHGFV
ECLEVEDLEVPETEAYQEDGEDADGGDESSRLHSQTRLYAMRLLLFSLSQPGPNLAHFLL
GYNTRKPVNKTELQDPGVLGSSRTCLHAVVSVLERGITSHSGPSAIHNTPQLAELAYELV
YRLCANRETSAPTMRYLRTTQDFFYKHLRHAPFTNKHGEDTEERILLNQQAWLLKAVAIE
LRMTAVNRQRSHSQRLLRLLLEDTPSMANDDADGSLDGDRLGEATFAEETSALGSSMAHT
QGDAGGAGKIENGKEKKENFLKYLKRPRVKETVGQRSRVKMVALQMRRRILQLLDSVDFS
QAFPIPLRLESFEPSGVEQTILNCEEKNEYGVLLCNLRLLHHILMDQLNRHGASGSVAGQ
RSRVEMEIMEILKTAVSRNSVRQALGAKRHAFDAWRQVLEVLLTSLPQESLALEVRQKVT
VDILQELLQKVNHEDAVAELTSPVAGAFLLLAMTLRQCSISDRAQSVANLMSSQYVNVLD
GSMVQTFNPDASVLGGGGGGGSGGRGGGGGVKIPVVSLTSILKELLTFILSTSGVQQRVR
TNLYGTLLNYLQIPQKPREIPTLQGSASTAMNSGILEEHDRVMTANLAVIQEFGESFCEL
VCRDACDGHELGRTLALSVIDAINSIDRRGHWLSILTSKGYLRHFIEGLVHMDQALQSCL
QPTPEPMKALYIYESTLSLLMRVAESASGAQALLQMGLMERLGQCRFIDLRPEHHTMSHP
RLVEGMEAIAVDAFLPDVMSRYHQLLFPVLRLCTAILTSLGSQHKEATSQVLHFIMAHAD
TFTAILRDQHQRPEKASLEELSLLTGVVCTVMGEVDYFDPALLETTGPAHIPLQTHLTRL
HRQILALVPRFCTLDQWLKELKTTIEAWPRGAADGGKMEERHGKGGDADGKGTNARSAYL
EIVSHVLGYCRTVVVRSGNNANDCQIIFTPSLQEAVARDYQRLEASTVASLDVSKPPGLG
VIVRHLRQAAAEFVVAMETHQQSVHKLQNIADLPAEELKELSHSGVGSQTTSLSAQHRLQ
LATRRLTQDVRTKVQDLSLLFYSIECDMFLIWRHLEYYFLHCHPTGGPSAPFSLSFALRQ
APRNLGDLSSPSLNVSRDDGQSRFPPVSPQALGITQEDLKQLRLDATKCLNESLLKRVQE
IESRFAAQRRTRHAFVAALARRIRRLVTLDAPR
NT seq 6402 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgcatggcggttaatttgggctccaggatatggggtccatacaaggagctg
taccataccgtctccctcatcgtctccaagagatgcccagatccctaccaggagctggat
gctctcatcagaaaacacaagccagactttgtggcccttctcaagaacccggcaaagaat
gcccaacaccgagaacagatcaagaaagccgatgttgagggcgtcgtcatctctggccag
gcaaggagtcgtgtgttgccacggcaactcatcgaggaggccctcctcatcagtgacctg
tttgatttaaacgagtatgctgccgttgaacttctcctggcaggtgaccaacagcagcct
cactttcctggtctgccccgcggcctggtggccgttcttctctactacgatggtcgctgc
agcctgatcaacgccctccagctcctgatccagtcccggcggggtcgcacatggaccttt
gacctggacaaggaggtcgttgaccttgtgacctcgttcaccgatgacctcgtctccgaa
gggctggtcggtaaggtgctccagtttctgaagaagatggatatcgtcaaggagatgaat
gatatggccaaggagagagctctgggaggtccgaagcacaggcatgatatccaggagttc
atgcgtggtgtccgtatctctctcgccgactgcctctactgcttcgcctgtcagacgccc
tttggaagaaaggataccattcttctcgccaagcatctcatgagcggcatcgagctgaac
gccgacggcacctttgacgagtcctccgtagctcttctcatggccttcctgtacagcatt
gatacgggtgtggttgagcagagaccagaagacagagatgagaatgaacagcacctgcca
atcctgaaggacaagcagtatctccccaagatccacgacctcatgatctctgaggacgaa
ggtcaatggaaggtcaaaggggtcaagggggtcatgcagctggcttgggcgttgaccctc
cggaattcggcccagcttccagaactatcaggattccagaatgagatagaagatgatgag
atcctagtagatcgagccatgcaggcagatgctttctccttcatcaacaaatgtgtcatc
gccaacaaagtcttccatcaaaatgaattctacgtacgacgaatccatggcctcataaca
gacttcatctttcagatgcccctcaaagtgaaagagatccgtaaccgtggtgatgaggct
ggtcgtctcatcatgtcctacgagagggaaggtctagaagtcaactctaacctgcctcga
cactttgaagacttcttacacctgtttgggtatctgtacgaaaaggaccctcttcagttg
gagctgtcccttgactattggaatccacctgagagggggagtagccctgggggtggaggg
ggtgctagctacctcagcatgtatcatcacaaacaatcccaaagacaagtgagcctcttc
aagtttgtccgcatggccggggacctccttcccccatccctgtacatcccgtacctacac
atgctgcaaggcctggcccacggacctcagagtgcacaccactgcttcaacctactcaag
gccaacggaatgggaggagctggggcaagtatgggcagtgtttcctgggaccacttcttc
ctctccttaaaccgctactactcgtccctccggcaggagatccgctccacctccccgttc
caggaagtggggcacaccgcccagtcattcaggcttggggctaaggggatcactccacaa
gagatggaggggttgaacaacgtcctcagactgatacaagttgttgctaaagagaacgag
gatgcaaggcgagccatggtagagaaccagtcctggttgccgtccgttctgctctttggt
ctcctgacgtgtagcatccctccaccgctgaaagcagagtgccttcgaaaccctggcggc
tttgcccagtcaccagagattgcagggaccctctggcaatcactggaggtatcacagatc
ataccaaccatccaccaagccggtgttcctccttccgggatcctcctcgagctggaagaa
attgaatccaacaacgaggagtttcccctcacccgtgggttcctggccatggtcgacacc
ctgacggagataccagtgcccccgatgttgggcgtcggctacaggccaccaggtttcgac
ccctatctcaagttcctcagggattcggtgttcctcaagttccgctcaagggcataccgc
aacccagctgaaaagtgggaagttgcagctgctgtgaccaagatcctctccaagctcctg
gccgcccatgaaccccacgcagaggagttcctggaccacgtcgtcgagctccagggagga
ggtacggccatcaccaacaagcctccgggacaccatctcctcgtccacatgctcaatgac
agctccatgctgcagctgatcctaagcatcttggatgagagcacccgcctcctctcccag
taccacgccttccccggcaaggagagcatgacagagtgcgccctctattgcctgaccatg
cttgacctcgccctggagaagcaggacaggttcattgacctcctcagaggtcaagggtca
agtcaaatggtcactccgctggaccagctactgatggggatcaacccccgctctggacgt
gccgatcacctttgccacattgccaaatttgtcagtttcaatgtgtctcttccgaagcat
gccttggcggcggtcaaggtactctacagaatggtcaagtcctccaatgtccagcctgag
atcgtgaacctcttttctatcaataaggaggagtctggaggcatcctgcatgggtttgtg
gagtgcctggaggtggaagatctggaggtacccgagacagaagcataccaagaagacgga
gaagatgctgacggaggtgatgaatcttcgaggcttcacagccaaacccgtctgtatgcc
atgcgcctacttctcttctccctctcccaaccggggccaaacctcgcccactttctcttg
ggctacaacacgaggaaacctgtcaacaagactgaacttcaagacccaggtgtcctaggt
tcctcccgcacctgtcttcacgctgtagtctctgtcttagaacgtggaatcacctcccac
tctggcccctctgccatccacaacacaccccagctggccgagcttgcctacgagctcgtc
taccgcctctgtgccaaccgggagaccagtgctccgaccatgcgctacctccgcaccacc
caagacttcttctacaagcatctcagacatgctcccttcaccaacaaacatggagaagac
acagaagagcgcatccttcttaaccagcaggcgtggcttctcaaggccgttgccatagag
ctaaggatgacagctgtcaatcgacaacgttcccatagccaacgtctgctccgcctcctc
ctcgaggacacgccctcaatggccaacgatgatgctgacgggtcactagatggcgacaga
ctgggtgaggctacctttgcggaagaaacaagtgcgcttggatctagtatggctcataca
cagggtgacgcaggtggtgcaggtaagattgaaaatgggaaggaaaagaaagaaaatttc
ttgaagtatttgaagaggccacgagtcaaagagacggtgggtcaaaggtcgagggtcaag
atggtggcccttcaaatgagacgccgaatcctgcagctcctggactcggtggacttctcc
caggccttccccatccccctccgtctggagtccttcgagccctccggcgtggagcagacc
atcctcaactgcgaggagaagaacgagtacggcgtgctgctctgcaacctcaggctcctt
catcacatcctcatggaccagctcaatcgacacggggcgtcggggtcagtcgcaggtcaa
aggtcgagggtcgagatggaaatcatggaaattctgaagacggctgtgtcgaggaacagc
gtcagacaagcccttggtgccaagcgtcatgcctttgatgcctggcgtcaggttctggag
gttctcctgacatccttgcctcaggagtccctggcactggaggtacgacagaaggtcact
gtggatatccttcaagaactgctccagaaggtcaaccatgaggacgcggtcgccgagctg
acctctcccgttgccggggccttcctcctcctggccatgaccctgcggcagtgctccatc
tcggaccgcgcccagtcggtagccaatctcatgtcgtctcagtacgtcaatgtcctggat
gggtctatggtccagaccttcaacccagatgcgtccgtcctcggcggaggagggggagga
gggagcgggggaaggggcggaggaggaggggtcaagataccggtggtgtcgttgacatcg
atcctgaaagaactcctcacattcatcctctccacaagtggggtccagcagcgggtccgg
accaacctctacggcaccctgctcaactacctgcagatcccccagaagccgcgggagatc
cccaccctccagggctccgcctccacagccatgaactctggcatcctggaggagcacgac
cgtgtcatgaccgccaacctggccgtcatccaggagtttggagagtctttctgcgagctc
gtctgcagggatgcgtgcgacggccacgaacttgggaggaccttagcactgtctgtcatc
gatgccatcaactccatcgaccgtcgcggtcactggcttagtatcctcacctccaagggc
tacctgagacacttcatcgagggacttgtgcacatggaccaagccctgcagagctgtctg
caacccaccccggaaccaatgaaggcgctatacatctatgaatccactttgtccctcttg
atgcgagtagcggagagtgcaagcggcgcccaagcactgctacagatgggtctgatggag
agactaggccagtgcaggttcattgatcttaggccggaacaccacacaatgagccatcct
aggctagttgaagggatggaagcgattgctgtggatgccttccttcccgatgtcatgagc
cgctatcaccaactcctcttcccagtcctaaggctctgtactgcaattctcacttcacta
ggcagtcaacacaaagaagcaaccagtcaggtcctccacttcatcatggctcacgccgac
accttcacggcgatcctgcgagaccagcaccagcgccctgagaaggcatccctggaagag
ctttccctcctgacgggggtcgtctgtacagtcatgggagaagtggactatttcgacccc
gccctgttggagaccaccggccctgcccacatccccctccagacgcacctgacccggctc
caccggcagatcctcgccctggtgccccgcttctgcaccctggaccagtggctgaaagag
ctgaagaccaccatcgaggcgtggccgaggggcgcggccgatggagggaagatggaggag
aggcacgggaagggtggggatgcggatgggaaaggaacgaacgcaagatcagcgtacctg
gagattgtgagccatgtattggggtactgtcgcacagtggtggttcgatcaggtaacaat
gccaatgactgtcagatcatcttcacaccatctctccaggaggctgttgcaagagactac
caaagactggaagcgtcaactgtggcttcacttgatgtcagcaagccgcctggtttgggc
gtcatcgtcagacatctccgtcaggctgccgcagaatttgtggttgccatggaaacgcat
cagcagtcggtccacaagctgcagaatattgcagatcttccagccgaggagttaaaagag
ttgtcacatagcggcgttggttctcagacgaccagtctttccgcccagcaccgtcttcaa
ttggcaacgcggaggctcacccaagacgtccgtaccaaagtccaggatctctcgcttctc
ttttattccattgaatgcgacatgtttcttatatggcgccatctggagtactacttcttg
cattgtcacccgacgggaggtccctctgcacccttctcgctctctttcgccctccggcag
gccccgagaaacctaggagatctgtccagtccatcactaaacgtgtcccgagacgacggt
caatcccgcttcccgccggtcagccctcaagccctcggtatcacccaggaagacctcaaa
cagctccgtctggacgccaccaagtgcctcaacgaatcgctcctcaagcgcgtccaagag
attgagagccgtttcgcagctcagcgtcggacgcgacatgcttttgtggcggcgttggcg
cggcgtatacgtcgactcgtcaccttggacgcgcccaggtga

DBGET integrated database retrieval system