KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576076Help
Entry
576076            CDS       T01019                                 

Gene name
nup205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:spu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2128 aa AA seqDB search
MAERMAVNLGSRIWGPYKELYHTVSLIVSKRCPDPYQELDALIRKHKPDFVALLKNPAKN
AQHREQIKKADVEGVVISGQARSRVLPRQLIEEALLISDLFDLNEYAAVELLLAGDQQQP
HFPGLPRGLVAVLLYYDGRCSLINALQLLIQSRRGRTWTFDLDKEVVDLVTSFTDDLVSE
GLVGKVLQFLKKMDIVKEMNDMAKERALGGPKHRHDIQEFMRGVRISLADCLYCFACQTP
FGRKDTILLAKHLMSGIELNADGTFDESSVALLMAFLYSIDTGVVEQRPEDRDENEQHLP
ILKDKQYLPKIHDLMISEDEGQWKVKGVKGVMQLAWALTLRNSAQLPELSGFQNEIEDDE
ILVDRAMQADAFSFINKCVIANKVFHQNEFYVRRIHGLITDFIFQMPLKVKEIRNRGDEA
GRLIMSYEREGLEVNSNLPRHFEDFLHLFGYLYEKDPLQLELSLDYWNPPERGSSPGGGG
GASYLSMYHHKQSQRQVSLFKFVRMAGDLLPPSLYIPYLHMLQGLAHGPQSAHHCFNLLK
ANGMGGAGASMGSVSWDHFFLSLNRYYSSLRQEIRSTSPFQEVGHTAQSFRLGAKGITPQ
EMEGLNNVLRLIQVVAKEIIPTIHQAGVPPSGILLELEEIESNNEEFPLTRGFLAMVDTL
TEIPVPPMLGVGYRPPGFDPYLKFLRDSVFLKFRSRAYRNPAEKWEVAAAVTKILSKLLA
AHEPHAEEFLDHVVELQGGGTAITNKPPGHHLLVHMLNDSSMLQLILSILDESIRLLSQY
YILQRVLSRSPQSSPSLTWCNGKPLYFYITMQAYTYKQHLKILSILDESTRLLSQYHAFP
GKESMTECALYCLTMLDLALEKQDRFIDLLRGQGSSQMVTPLDQLLMGINPRSGRADHLC
HIAKFVSFNVSLPKHALAAVKVLYRMVKSSNVQPEIVNLFSINKEESGGILHGFVECLEV
EDLEVPETEAYQEDGEDADGGDESSRLHSQTRLYAMRLLLFSLSQPGPNLAHFLLGYNTR
KPVNKTELQDPGVLGSSRTCLHAVVSVLERGITSHSGPSAIHNTPQLAELAYELVYRLCA
NRETSAPTMRYLRTTQDFFYKHLRHAPFTNKHGERILLNQQAWLLKAVAIELRMTAVNRQ
RSHSQRLLRLLLEDTPSMANDDADGSLDGDRLGEATFAEETSALGSSMAHTQGDAGGAAL
QMRRRILQLLDSVDFSQAFPIPLRLESFEPSGVEQTILNCEEKNEYGVLLCNLRLLHHIL
MDQLNRHGASGSVAGQRSRVEMEIMEILKTAVSRNSVRQALGAKRHAFDAWRQVLEVLLT
SLPQESLALEVRQKVTVDILQELLQKVNHEDAVAELTSPVAGAFLLLAMTLRQCSISDRA
QSVANLMSSQYVNVLDGSMVQTFNPDASVLGGGGGGGSGGRGGGGGVKIPVVSLTSILKE
LLTFILSTSGVQQRVRTNLYGTLLNYLQIPQKPREIPTLQGSASTAMNSGILEEHDRVMT
ANLAVIQEFGESFCELVCRDACDGHELGRTLALSVIDAINSIDRRGHWLSILTSKGYLRH
FIEGLVHMDQALQSCLQPTPEPMKALYIYESTLSLLMRVAESASGAQALLQMGLMERLGQ
CRFIDLRPEHHTMRLVEGMEAIAVDAFLPDVMSRYHQLLFPVLRLCTAILTSLGSQHKEA
TSQVLHFIMAHADTFTAILRDQHQRPEKASLEELSLLTGVVCTVMGEVDYFDPALLETTG
PAHIPLQTHLTRLHRQILALVPRFCTLDQWLKELKTTIEAWPRGAADGGKMEERHGKGGD
ADGKGTNARSAYLEIVSHVLGYCRTVVVRSGNNANDCQIIFTPSLQEAVARDYQRLEAST
VASLDVSKPPGLGVIVRHLRQAAAEFVVAMETHQQSVHKLQNIADLPAEELKELSHSGVG
SQTTSLSAQHRLQLATRRLTQDVRTKVQDLSLLFYSIECDMFLIWRHLEYYFLHCHPTGG
PSAPFSLSFALRQAPRNLGDLSSPSLNVSRDDGQSRFPPVSPQALGITQEDLKQLRLDAT
KCLNESLLKRVQEIESRFAAQRRTRHAFVAALARRIRRLVKLSRNTTEAMSPASFSCTLI
HTCGVCPAYRLQIYGNYRFVGRFWSGCH
NT seq 6387 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgcatggcggttaatttgggctccaggatatggggtccatacaaggagctg
taccataccgtctccctcatcgtctccaagagatgcccagatccctaccaggagctggat
gctctcatcagaaaacacaagccagactttgtggcccttctcaagaacccggcaaagaat
gcccaacaccgagaacagatcaagaaagccgatgttgagggcgtcgtcatctctggccag
gcaaggagtcgtgtgttgccacggcaactcatcgaggaggccctcctcatcagtgacctg
tttgatttaaacgagtatgctgccgttgaacttctcctggcaggtgaccaacagcagcct
cactttcctggtctgccccgcggcctggtggccgttcttctctactacgatggtcgctgc
agcctgatcaacgccctccagctcctgatccagtcccggcggggtcgcacatggaccttt
gacctggacaaggaggtcgttgaccttgtgacctcgttcaccgatgacctcgtctccgaa
gggctggtcggtaaggtgctccagtttctgaagaagatggatatcgtcaaggagatgaat
gatatggccaaggagagagctctgggaggtccgaagcacaggcatgatatccaggagttc
atgcgtggtgtccgtatctctctcgccgactgcctctactgcttcgcctgtcagacgccc
tttggaagaaaggataccattcttctcgccaagcatctcatgagcggcatcgagctgaac
gccgacggcacctttgacgagtcctccgtagctcttctcatggccttcctgtacagcatt
gatacgggtgtggttgagcagagaccagaagacagagatgagaatgaacagcacctgcca
atcctgaaggacaagcagtatctccccaagatccacgacctcatgatctctgaggacgaa
ggtcaatggaaggtcaaaggggtcaagggggtcatgcagctggcttgggcgttgaccctc
cggaattcggcccagcttccagaactatcaggattccagaatgagatagaagatgatgag
atcctagtagatcgagccatgcaggcagatgctttctccttcatcaacaaatgtgtcatc
gccaacaaagtcttccatcaaaatgaattctacgtacgacgaatccatggcctcataaca
gacttcatctttcagatgcccctcaaagtgaaagagatccgtaaccgtggtgatgaggct
ggtcgtctcatcatgtcctacgagagggaaggtctagaagtcaactctaacctgcctcga
cactttgaagacttcttacacctgtttgggtatctgtacgaaaaggaccctcttcagttg
gagctgtcccttgactattggaatccacctgagagggggagtagccctgggggtggaggg
ggtgctagctacctcagcatgtatcatcacaaacaatcccaaagacaagtgagcctcttc
aagtttgtccgcatggccggggacctccttcccccatccctgtacatcccgtacctacac
atgctgcaaggcctggcccacggacctcagagtgcacaccactgcttcaacctactcaag
gccaacggaatgggaggagctggggcaagtatgggcagtgtttcctgggaccacttcttc
ctctccttaaaccgctactactcgtccctccggcaggagatccgctccacctccccgttc
caggaagtggggcacaccgcccagtcattcaggcttggggctaaggggatcactccacaa
gagatggaggggttgaacaacgtcctcagactgatacaagttgttgctaaagagatcata
ccaaccatccaccaagccggtgttcctccttccgggatcctcctcgagctggaagaaatt
gaatccaacaacgaggagtttcccctcacccgtgggttcctggccatggtcgacaccctg
acggagataccagtgcccccgatgttgggcgtcggctacaggccaccaggtttcgacccc
tatctcaagttcctcagggattcggtgttcctcaagttccgctcaagggcataccgcaac
ccagctgaaaagtgggaagttgcagctgctgtgaccaagatcctctccaagctcctggcc
gcccatgaaccccacgcagaggagttcctggaccacgtcgtcgagctccagggaggaggt
acggccatcaccaacaagcctccgggacaccatctcctcgtccacatgctcaatgacagc
tccatgctgcagctgatcctaagcatcttggacgagagcatccgtctcctgtctcaatac
tacatcttacagagagtcctttccaggtctccccaatcctccccctccctcacatggtgc
aacggcaagcctctgtatttctacatcaccatgcaagcctatacttataagcagcaccta
aaaatcctaagcatcttggatgagagcacccgcctcctctcccagtaccacgccttcccc
ggcaaggagagcatgacagagtgcgccctctattgcctgaccatgcttgacctcgccctg
gagaagcaggacaggttcattgacctcctcagaggtcaagggtcaagtcaaatggtcact
ccgctggaccagctactgatggggatcaacccccgctctggacgtgccgatcacctttgc
cacattgccaaatttgtcagtttcaatgtgtctcttccgaagcatgccttggcggcggtc
aaggtactctacagaatggtcaagtcctccaatgtccagcctgagatcgtgaacctcttt
tctatcaataaggaggagtctggaggcatcctgcatgggtttgtggagtgcctggaggtg
gaagatctggaggtacccgagacagaagcataccaagaagacggagaagatgctgacgga
ggtgatgaatcttcgaggcttcacagccaaacccgtctgtatgccatgcgcctacttctc
ttctccctctcccaaccggggccaaacctcgcccactttctcttgggctacaacacgagg
aaacctgtcaacaagactgaacttcaagacccaggtgtcctaggttcctcccgcacctgt
cttcacgctgtagtctctgtcttagaacgtggaatcacctcccactctggcccctctgcc
atccacaacacaccccagctggccgagcttgcctacgagctcgtctaccgcctctgtgcc
aaccgggagaccagtgctccgaccatgcgctacctccgcaccacccaagacttcttctac
aagcatctcagacatgctcccttcaccaacaaacatggagagcgcatccttcttaaccag
caggcgtggcttctcaaggccgttgccatagagctaaggatgacagctgtcaatcgacaa
cgttcccatagccaacgtctgctccgcctcctcctcgaggacacgccctcaatggccaac
gatgatgctgacgggtcactagatggcgacagactgggtgaggctacctttgcggaagaa
acaagtgcgcttggatctagtatggctcatacacagggtgacgcaggtggtgcagccctt
caaatgagacgccgaatcctgcagctcctggactcggtggacttctcccaggccttcccc
atccccctccgtctggagtccttcgagccctccggcgtggagcagaccatcctcaactgc
gaggagaagaacgagtacggcgtgctgctctgcaacctcaggctccttcatcacatcctc
atggaccagctcaatcgacacggggcgtcggggtcagtcgcaggtcaaaggtcgagggtc
gagatggaaatcatggaaattctgaagacggctgtgtcgaggaacagcgtcagacaagcc
cttggtgccaagcgtcatgcctttgatgcctggcgtcaggttctggaggttctcctgaca
tccttgcctcaggagtccctggcactggaggtacgacagaaggtcactgtggatatcctt
caagaactgctccagaaggtcaaccatgaggacgcggtcgccgagctgacctctcccgtt
gccggggccttcctcctcctggccatgaccctgcggcagtgctccatctcggaccgcgcc
cagtcggtagccaatctcatgtcgtctcagtacgtcaatgtcctggatgggtctatggtc
cagaccttcaacccagatgcgtccgtcctcggcggaggagggggaggagggagcggggga
aggggcggaggaggaggggtcaagataccggtggtgtcgttgacatcgatcctgaaagaa
ctcctcacattcatcctctccacaagtggggtccagcagcgggtccggaccaacctctac
ggcaccctgctcaactacctgcagatcccccagaagccgcgggagatccccaccctccag
ggctccgcctccacagccatgaactctggcatcctggaggagcacgaccgtgtcatgacc
gccaacctggccgtcatccaggagtttggagagtctttctgcgagctcgtctgcagggat
gcgtgcgacggccacgaacttgggaggaccttagcactgtctgtcatcgatgccatcaac
tccatcgaccgtcgcggtcactggcttagtatcctcacctccaagggctacctgagacac
ttcatcgagggacttgtgcacatggaccaagccctgcagagctgtctgcaacccaccccg
gaaccaatgaaggcgctatacatctatgaatccactttgtccctcttgatgcgagtagcg
gagagtgcaagcggcgcccaagcactgctacagatgggtctgatggagagactaggccag
tgcaggttcattgatcttaggccggaacaccacacaatgaggctagttgaagggatggaa
gcgattgctgtggatgccttccttcccgatgtcatgagccgctatcaccaactcctcttc
ccagtcctaaggctctgtactgcaattctcacttcactaggcagtcaacacaaagaagca
accagtcaggtcctccacttcatcatggctcacgccgacaccttcacggcgatcctgcga
gaccagcaccagcgccctgagaaggcatccctggaagagctttccctcctgacgggggtc
gtctgtacagtcatgggagaagtggactatttcgaccccgccctgttggagaccaccggc
cctgcccacatccccctccagacgcacctgacccggctccaccggcagatcctcgccctg
gtgccccgcttctgcaccctggaccagtggctgaaagagctgaagaccaccatcgaggcg
tggccgaggggcgcggccgatggagggaagatggaggagaggcacgggaagggtggggat
gcggatgggaaaggaacgaacgcaagatcagcgtacctggagattgtgagccatgtattg
gggtactgtcgcacagtggtggttcgatcaggtaacaatgccaatgactgtcagatcatc
ttcacaccatctctccaggaggctgttgcaagagactaccaaagactggaagcgtcaact
gtggcttcacttgatgtcagcaagccgcctggtttgggcgtcatcgtcagacatctccgt
caggctgccgcagaatttgtggttgccatggaaacgcatcagcagtcggtccacaagctg
cagaatattgcagatcttccagccgaggagttaaaagagttgtcacatagcggcgttggt
tctcagacgaccagtctttccgcccagcaccgtcttcaattggcaacgcggaggctcacc
caagacgtccgtaccaaagtccaggatctctcgcttctcttttattccattgaatgcgac
atgtttcttatatggcgccatctggagtactacttcttgcattgtcacccgacgggaggt
ccctctgcacccttctcgctctctttcgccctccggcaggccccgagaaacctaggagat
ctgtccagtccatcactaaacgtgtcccgagacgacggtcaatcccgcttcccgccggtc
agccctcaagccctcggtatcacccaggaagacctcaaacagctccgtctggacgccacc
aagtgcctcaacgaatcgctcctcaagcgcgtccaagagattgagagccgtttcgcagct
cagcgtcggacgcgacatgcttttgtggcggcgttggcgcggcgtatacgtcgactcgtg
aaattgtcaaggaacacgactgaagcaatgtccccagccagtttttcttgcactttaata
cacacatgtggtgtgtgtccagcttaccgtcttcaaatatatggtaactacagatttgta
ggacggttctggtctggatgtcattag

DBGET integrated database retrieval system