KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576084Help
Entry
576084            CDS       T01019                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    576084
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    576084
  Amino acid metabolism
   00310 Lysine degradation
    576084
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     576084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 485 aa AA seqDB search
MAMLSANLLRKIPRFHLRGVSFTPEKACIARNIKSSIAFSEGCQWRAYSQLAKHQQTLRI
RPVLGAFQSQPIWELNGCKGLQTSHYHYDEVRIVETPPFAESVSEGDVRWDKGVGDFVEE
DEVVGEIETDKTSIPVPAPCRGVILEFLIPDGEKVVPGQQLLKIQVSAGDAPKKAAPDAA
AAPPPTPPPPAAAPAAPPAGASAGPIPSTPPPAPSIPTGPMTSKPASSVPIQPAAAAAAQ
QAMSAEMPAGYGVRSEQRVKMSRMRQRIAQRLKEAQNTTAMLTTFNEIDMSNIIAVRNKH
KDAFIKKHGVKLGFMSAFVKASSYALKEMPVVNAVIDENEIVYRDYVDISVAVATPKGLV
VPVLRNSDGMSFADVEKGLNELGEKARSGTLAVEDMDGGTFTISNGGVFGSMFGTPIINP
PQSAILGMHASFDRPVAINGKVEIRPMMYIALTYDHRLIDGREAVLFLRKIKAGVEDPSI
YLLEM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgctgtccgctaatttactgaggaaaattcctcgatttcatctaagaggagtt
tcttttacacctgaaaaggcatgcatagcaaggaacatcaagtccagtatagccttctct
gaggggtgccaatggagggcatacagccagcttgcaaagcaccagcaaactctaaggata
cgaccagtgctaggcgccttccagtctcaaccaatctgggagctaaatggttgtaaagga
ctccaaacttcacattatcattatgatgaggttaggatcgtagaaacacctcctttcgca
gagtccgtgtcagagggtgatgtgaggtgggataaaggtgttggagattttgtagaggaa
gatgaagttgtgggagagatagagacagacaagacttctatcccagtaccagcaccatgt
agaggagtcatccttgagttcttgattccagatggagagaaggttgtaccgggtcaacaa
cttctcaagatacaagtctcagccggagatgcccccaagaaagctgctccagatgctgcc
gcagcccctcctcctacccctccaccacctgcagctgccccagcagcaccccctgctgga
gcctcagctggacctataccctcaacaccgccaccggcgccctctatacctacagggcct
atgacgtcaaaaccagcatcatcagtccccattcaaccagcagcagcagcagcagcccag
caagccatgtcagctgagatgcctgctggatatggagtaagatcggaacagagggttaaa
atgtccagaatgagacagaggatagcacagagacttaaggaagcacagaacaccactgca
atgcttactactttcaatgagatagatatgagtaacatcatagcagtgaggaataaacac
aaagatgctttcatcaagaagcatggggtcaagttgggcttcatgtcagctttcgtcaag
gcatcgtcctacgcactcaaggaaatgccagtcgtcaatgcagttattgatgagaatgaa
atagtgtatcgggattacgtggacatcagcgttgccgtggcgactccaaagggtctagtt
gttccagttcttcggaattcagatggcatgagctttgctgatgttgaaaagggactcaat
gagcttggtgaaaaggcccgatcaggaaccctagcagtggaggacatggatggaggcaca
ttcactatcagcaatgggggtgtctttggttctatgtttggtactcctatcatcaacccc
cctcaatcagctatccttggcatgcacgcctccttcgacagaccggtcgctataaacgga
aaggttgaaattaggcctatgatgtacatcgccttgacatacgaccacagactgattgac
ggcagggaagcggtcttgttccttcgcaagatcaaggccggggtagaagaccctagcatc
tacctactagaaatgtga

DBGET integrated database retrieval system