KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576086Help
Entry
576086            CDS       T01019                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate synthase
  KO
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    576086
  Amino acid metabolism
   00330 Arginine and proline metabolism
    576086
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     576086
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     576086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 830 aa AA seqDB search
MWNPTMASFASLSRAVSASTTATHLKTLLNPEISFLQQSRLLFSYLSHRNSQAPTTTRTG
NNDGHLQRLSTHNLIANSMSSLRSVSTTAGCKKSATSRAELKSSKRIVLKLGSAVITRDD
ECGLALGRLASIVEQVSELQSSGRQVVLVTSGAVAFGKQRLRHEVMLSKSIKQTLAPNSS
SIIQMDSRACAAAGQSGLMSLYEAMFSQYGLTTAQVLVTKPDFYHDYTRSNLRGTMQELL
RMNIIPIINSNDAVVPPPEEDKDLAGVRTGVISIKDNDSLAARLAIEINADLLVLLSDVD
GIFSAPPGQEGASFLDTVYPGDTAFIEFKGTSRVGLGGMESKVKAANWALERGCSVVIGN
GMNRDDIVLNILNGRKVGTFFTETKPTGVSPEMQAIKARDGGRLLQALTSEQRAEVIIRL
ADLLIERSSTIMAANRRDIDEARLSNMTGPNLSRLALTDAKLKSLSDGLRQIAATSHKNV
GREIKRTLLSDGMLLRQVTVPIGVLMVIFESRPDCLPQVAALAISSANGLLLKGGKEASY
SNEVLHSLVEEALEMHDAKDAVALISTREQVGDLLKMSDDIDLVIPRGSKEMVQLIQQQS
EGIPVLGHSEGICHVYIDEEADLDMALKIIRDSKCDYPAACNAMETLLIHKKFRHTQVFE
DILDMLRAENVKFNPGPRLARSLKFGPREADSMSIEYGGLECAVEIVDDVTGAINHVHKH
GSSHTDVIVTNNEETADEFMKNVDSACVFHNASTRFSDGYRFGLGAEVGISTTRIHARGP
VGVEGLLTTKWILEGSGDTVQEYAAGGSKMFVHQELEVENGEEVLESSSA
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatcctacaatggccagttttgcaagtctatcccgtgctgtgagtgcaagcaca
acagcaacacacctaaagactctgctcaatcctgaaatcagcttcttacaacagtctcga
ctactgttcagttacctgtcacatcggaatagccaagcaccgacaacaaccaggactggc
aacaatgatggacaccttcaaaggttgtccactcataaccttattgcaaatagtatgtct
tccctgaggtccgtatcaacgactgcagggtgtaagaagtcggcgacgtcgagagcggag
ctgaagagcagcaaaaggatagtcctgaagctaggtagtgctgtgatcacaagagacgat
gagtgtgggttggccctaggtaggctggcttccatcgtagaacaggtttcagagctccaa
tcttcaggcagacaggtcgtactggtcaccagtggagctgtggcattcgggaagcagagg
ctacgccatgaagtcatgctgtcaaagagcatcaaacaaactcttgccccaaattcttct
agcattattcagatggattcaagagcctgtgctgctgctggacagagtggtttgatgtct
ctgtacgaagctatgttctcacaatatgggctcactactgctcaggtactggtgaccaag
ccggacttctaccacgactacacccgcagcaacctccggggcaccatgcaggagctgctg
cggatgaacatcatccccatcatcaactccaacgatgcggtggtcccgcccccagaggag
gacaaggacttggccggggtaagaacaggggtcattagtatcaaggacaatgacagcctg
gcagcccgtcttgctattgagatcaatgctgatctacttgtcctgctttccgacgtcgac
ggcatcttctccgctcctcctggtcaagagggggcgtccttcttagatacggtctaccct
ggagacacagctttcattgagtttaaagggacttctcgtgttgggcttggcggtatggaa
tcaaaggtcaaagcagccaactgggcgctggagcgcggctgctccgtcgtgatcggcaac
ggcatgaacagggacgacatcgtcctcaacatcctcaacgggcggaaggtgggcaccttc
ttcacggagaccaaacccacgggcgtgtccccggagatgcaggctataaaagccagagac
ggtggcaggctactccaggcactcacttccgaacagagagctgaggtaataatacgtcta
gctgacctcttgattgaaaggtcatcaaccatcatggcggctaacaggagggacattgat
gaggctaggctaagtaatatgactggacctaacctgtccagactagcgctgaccgatgcc
aagctgaagagcctgtccgacggtctgaggcagattgcggccacctctcacaagaatgtt
ggccgagagatcaagaggacattgctgtccgatggcatgttgctgcgacaggtcaccgtg
ccgatcggagtgctcatggttatcttcgagtccaggccagactgtctgccgcaggtagca
gcactggccatcagcagtgccaatggtctactcctgaagggaggcaaggaagcaagttat
agtaatgaggtgctacactctctagtagaagaagccctggagatgcatgatgccaaagat
gctgtagcactgatcagtaccagagagcaggtcggtgacttgctgaagatgtccgacgac
attgacctggtcattccacgaggttccaaggagatggttcagctcattcagcagcagagt
gagggtatcccagtcctcggacacagcgagggcatctgtcatgtctacatcgacgaggag
gcggatctcgacatggccctgaagattatccgtgattctaagtgcgattatccagccgcc
tgcaacgctatggagacgctactcatccacaaaaagttcagacatactcaagtctttgaa
gatatccttgatatgctgagagcagaaaatgtcaaattcaacccaggccctcgcttggcc
cgatccctcaagtttggaccacgggaggcagactcgatgagcatcgagtacggtggcctg
gagtgcgcagtagaaatagttgacgacgtcacaggtgcaatcaaccatgtccacaaacat
ggcagctcccatacagatgtgattgttacaaataatgaagagacagcggatgaattcatg
aagaacgtggacagtgcctgtgtcttccacaatgccagcactcgtttctctgatggatac
cgatttggattgggagctgaagtcggtatcagcaccacaaggatccacgcccggggaccg
gttggggtggagggcctcctcaccaccaagtggatccttgagggatccggagacactgtg
caggagtacgcagcaggagggagcaagatgtttgtacaccaggagctcgaggtggagaat
ggggaggaggtcctggagtcttcatcagcatag

DBGET integrated database retrieval system