KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576191Help
Entry
576191            CDS       T01019                                 

Definition
circadian locomoter output cycles protein kaput-like
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 318 aa AA seqDB search
MNYGKRSSLPKTNRKICDMYDDGEDSKDTTKRKSRNASEKKRRDQFNVLIQELCSMVSTK
TRKLDKSAVLRATIHFLKAHNDMVMKSEKNAINENWKPSFLSDDEFSQLMLEALDGFMIV
FSQQGHILYTSDSVISLLRHLPKDLESCTIYELIHEDDRPEMFKILSRADPSNGTPDILG
QRFSFSCHMRRGTLEPDKPAEYEPIRFNGSFSLLKTGQAAAFTDMVTTPRYCFVATVRLL
STQLSREMATFTEKGNEFTSRHSLDWKFLFLDHRAPPIIGYLPFEVLGTSVYEYYQQDDL
DKLGRCHEACKFYTVFTL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaactacggaaagaggtcttccttaccgaagaccaacagaaaaatatgtgatatgtat
gatgatggtgaagatagtaaagataccacaaagaggaaatctcgcaatgcgagtgagaag
aagaggagagatcagttcaatgtacttatacaggagctatgctcaatggtttcgaccaag
acgagaaagctggacaagtccgcagtcctcagagccaccatacacttcttaaaggctcat
aatgacatggtgatgaaatccgagaagaacgcaatcaacgaaaactggaaaccgtcgttc
ctgtctgatgatgagttcagtcagctgatgttagaagctctggatggttttatgatagtc
ttctctcagcaaggccatatcttgtatacctcagacagtgtcatctctttgctgagacat
ttaccgaaagaccttgagtcgtgtacgatatatgaacttatccatgaagatgacagaccg
gagatgttcaagatcctctccagggcagatccgtccaacggcacaccagacatcctaggc
cagagattctccttctcctgtcacatgagacgagggacgttagaaccggacaaacctgca
gagtatgaacccatccgcttcaatggcagcttttccctgcttaagacaggccaagcggcg
gctttcactgacatggtcaccacccctaggtattgctttgtagcaacggtcagactcctc
tccacgcagcttagtagagagatggctactttcaccgagaaggggaacgaattcacatca
aggcatagtctcgactggaaattcctcttcttagaccacagggctcctccaatcattggt
tatctaccttttgaagtgctcggtacctcggtgtatgaatactatcagcaggatgatctg
gataaactcggcagatgccatgaagcatgtaagttttataccgttttcacactatga

DBGET integrated database retrieval system