KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576191Help
Entry
576191            CDS       T01019                                 

Definition
circadian locomoter output cycles protein kaput-like
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     576191
Transcription factors [BR:spu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    576191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 318 aa AA seqDB search
MNYGKRSSLPKTNRKICDMYDDGEDSKDTTKRKSRNASEKKRRDQFNVLIQELCSMVSTK
TRKLDKSAVLRATIHFLKAHNDMVMKSEKNAINENWKPSFLSDDEFSQLMLEALDGFMIV
FSQQGHILYTSDSVISLLRHLPKDLESCTIYELIHEDDRPEMFKILSRADPSNGTPDILG
QRFSFSCHMRRGTLEPDKPAEYEPIRFNGSFSLLKTGQAAAFTDMVTTPRYCFVATVRLL
STQLSREMATFTEKGNEFTSRHSLDWKFLFLDHRAPPIIGYLPFEVLGTSVYEYYQQDDL
DKLGRCHEACKFYTVFTL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaactacggaaagaggtcttccttaccgaagaccaacagaaaaatatgtgatatgtat
gatgatggtgaagatagtaaagataccacaaagaggaaatctcgcaatgcgagtgagaag
aagaggagagatcagttcaatgtacttatacaggagctatgctcaatggtttcgaccaag
acgagaaagctggacaagtccgcagtcctcagagccaccatacacttcttaaaggctcat
aatgacatggtgatgaaatccgagaagaacgcaatcaacgaaaactggaaaccgtcgttc
ctgtctgatgatgagttcagtcagctgatgttagaagctctggatggttttatgatagtc
ttctctcagcaaggccatatcttgtatacctcagacagtgtcatctctttgctgagacat
ttaccgaaagaccttgagtcgtgtacgatatatgaacttatccatgaagatgacagaccg
gagatgttcaagatcctctccagggcagatccgtccaacggcacaccagacatcctaggc
cagagattctccttctcctgtcacatgagacgagggacgttagaaccggacaaacctgca
gagtatgaacccatccgcttcaatggcagcttttccctgcttaagacaggccaagcggcg
gctttcactgacatggtcaccacccctaggtattgctttgtagcaacggtcagactcctc
tccacgcagcttagtagagagatggctactttcaccgagaaggggaacgaattcacatca
aggcatagtctcgactggaaattcctcttcttagaccacagggctcctccaatcattggt
tatctaccttttgaagtgctcggtacctcggtgtatgaatactatcagcaggatgatctg
gataaactcggcagatgccatgaagcatgtaagttttataccgttttcacactatga

DBGET integrated database retrieval system