KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576295Help
Entry
576295            CDS       T01019                                 

Definition
(RefSeq) 7-dehydrocholesterol reductase
  KO
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    576295
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     576295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 486 aa AA seqDB search
MTEPTSYSRPNTRSHSKRMSEEPMKRTTNGTSAVDRKAGQWGRAWEVDVFTTVGVLALLT
LIPLVVFYVHVACTHYQCSLITPPLEMQKGALTLTMLWDQMPSITWDGVTITAIWMTFQV
VLFYLPDLFQYIIPGYVGGMQLGAVTPSGIRNPYLINGLQAWFISNAIFVANALYFEWFS
PSIVFDHRGSLLWCANAIGIFVATFAIVKAYFFPTHAPDRVFTGNIFYDYMMGIEFNPRI
GKMFDFKLFFNGRPGIAAWTIINFSMAMKQYELYGYITNSMILVNFLELIYVVDYFWNEA
WYLHTIDMHHDHFGWYLAWGDMVYLPFMYTLQCFYLVFNPVDLSWPIFTAIFLLGTVGYY
IFRSVNRQKDYFRRTNGQAPIWGAMPKYIDATYMSGDGEERKSKLLLSGWWGITRHMNYT
GDLMQAAAWCLSCGVGHIFPYYYLVFMLILLIHRCRRDEDRCHAKYGKSWDLYMEKVPCR
LIPYIY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccgacttcttactcgcggcccaacacccggtctcattcaaaacgcatgtcg
gaagagcctatgaagcgcactaccaacggaacgtcggctgttgaccggaaggctggacaa
tgggggcgtgcatgggaggttgatgtgttcaccacggtgggggtactcgccctcctcacc
ctcatccccttggtagtattctacgtccacgtcgcttgtacccactaccaatgctctctc
atcacccctcccctggagatgcagaagggcgcccttaccctcaccatgctttgggatcag
atgccgtccatcacgtgggatggcgttaccataacagccatctggatgacctttcaggtt
gtgctcttctacttgccggatctcttccaatacattattcccggttacgtcggcggtatg
caactcggagccgtaacaccgtcgggtatccggaatccgtacctcatcaacggtttgcag
gcatggttcatctccaacgcaattttcgtggcaaacgccctctattttgaatggttctcg
ccatccattgtgttcgaccaccgcggctcgctcctgtggtgcgccaacgccatcggcatc
tttgtagctacattcgccatcgtgaaggcttacttcttcccgacccacgcccctgatcgt
gtcttcaccggtaacatcttctatgattacatgatgggaatcgagttcaacccccgcatc
ggaaagatgttcgatttcaagcttttcttcaacggtcgaccgggtatcgcagcctggacc
atcatcaacttctccatggccatgaagcagtacgagctctacggctacatcaccaactcc
atgatcctagtcaacttcctggagttgatctatgtggtggattacttctggaacgaggcc
tggtaccttcacaccatcgacatgcaccacgatcactttggatggtaccttgcctggggt
gatatggtctacctgccattcatgtatacgcttcagtgcttctacctggtgttcaacccc
gtcgatctctcctggcccatcttcaccgccatcttcctcctcggaaccgtcggctactac
atcttccggtcggtcaaccggcagaaggactacttccggcgcacaaacggacaagccccc
atttggggcgccatgcccaagtacatcgacgccacctacatgagcggtgacggggaggag
aggaagagcaagttattgctctcgggctggtggggtatcaccaggcatatgaactacact
ggtgacctgatgcaggcagcggcctggtgcctctcctgtggagtaggacacatcttcccg
tactactacctggtcttcatgctcatcctgctcatccaccgctgccggcgggacgaggac
cgctgtcatgccaagtacggcaaatcatgggacctctacatggagaaagtcccctgcagg
cttataccttacatctattga

DBGET integrated database retrieval system