KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576305Help
Entry
576305            CDS       T01019                                 

Gene name
usp3
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     576305 (usp3)
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   576305 (usp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 503 aa AA seqDB search
MECPHLSQNVKQEVCQIIKKSHGESTSSWVCAVCRSNKNPWMCLACGVVLCGRYVNGHAK
KHYEENQHSASINCENLAVYCYVCDDHALNDNKTETIKHVRQFLQAKVNLQYEKQLKTLT
GDVAGDHIDGPPRKKLAANTRANIPGLRNLGNTCFMNAVLQSLSNINQFCGYFKDLPAVE
LRSGKTAGKRIYNTRNMKHDDVSLVEEIRKTLCALWQGDQTAISPDSLFTVMWKIFPRFR
GYQQQDAHEFMRYLLDRLHTELQGSTWPTTPKKQTNGHATIVSVIFGGLLLSEVTCRPCG
SLYKKIDPFLDVSLDIPERFRPRSKNKDGSQVCRLQDCMQSFIAVEELEETEQYMCPKCQ
QRQPSTKKFWLKAIPNVLCIHLKRFTWSGFLRTKIDTYVQFPMKGLDIQPFMLGPECQDE
NVSTTVYDLAAVIVHQGSGAGAGHYIAFAVNNGQWYCFNDSTVTPVEEKVITRCKAYILF
YVSHQFKDDFLSFSSIHNGNIPS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtcctcacttgtcacagaatgtcaaacaagaagtttgtcaaataataaagaag
tcacacggcgaatccacttcgtcgtgggtatgtgcagtttgtcgatccaacaaaaatccc
tggatgtgtctagcttgtggagtagtcctatgtggaaggtatgtgaatggacatgccaag
aaacactatgaagaaaaccaacactctgcctccataaattgtgaaaacttagctgtatac
tgttatgtgtgtgatgaccatgccctaaacgataacaaaacagaaaccatcaaacatgtc
cgccaattccttcaggctaaagtcaacctccagtatgagaagcagctcaagactctaact
ggtgatgtagctggagatcacatagatggaccacctaggaaaaaactagcagcaaacacg
agggctaatattccagggttgcggaatctaggaaacacctgttttatgaatgctgtacta
caatcactgagtaacatcaaccaattctgtggctacttcaaagacttaccagctgtagag
cttaggagtggaaaaacagcaggaaagagaatctacaacacaagaaatatgaagcatgat
gatgtgtcattggtagaggagataaggaagacactatgtgctctatggcagggggaccag
acagctatctcacctgactcactcttcactgtcatgtggaagatattcccaaggttcagg
ggttaccagcagcaagacgctcatgagttcatgaggtacctactagacagactacacaca
gagctccaaggctccacctggccgaccacaccaaagaaacaaaccaacggccatgcaacc
attgtcagtgtcatctttggtggtcttctactcagtgaggtcacgtgtagaccctgtggc
tcactctacaagaagatagatccatttctagatgtgtcattagatattccagagagattt
agaccaagaagtaaaaacaaggatggttcacaagtatgtaggttacaagattgtatgcag
agtttcattgcggttgaggagctagaggaaacagagcagtacatgtgtccaaagtgtcaa
cagagacaaccatcaacaaagaagttctggctcaaagctatcccaaatgtgctatgtata
catctaaagaggttcacatggtcagggtttctacgaaccaagattgacacctatgtgcag
tttccaatgaaaggcttagatatacaaccattcatgctgggaccagagtgtcaagatgag
aatgtgagcacaaccgtttatgatttagctgcagtcattgtacatcaaggatcaggggct
ggtgctggacactatatagcatttgcagtcaacaacggtcagtggtactgcttcaacgat
agtacagtgacccccgtagaggagaaggtgatcaccaggtgtaaggcgtacatcctcttc
tacgtcagtcatcaattcaaggatgatttcctctccttctctagtatccacaatggaaac
attccatcatag

DBGET integrated database retrieval system