KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576342Help
Entry
576342            CDS       T01019                                 

Definition
aurora kinase A-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 374 aa AA seqDB search
MSWLDLFVLRVCLCGDIKLVYSRPRPRSRSRSRSTLGLSQTLLITNLYLSAFIMHVHLSL
QVASSLNRGTTAQARTQPVKSAENGHGHDDKQMEPKKSWTLKDFDIGRPLGKGKFGSVYL
AREKQTKYIVALKVLFKSQLQKAQVEHQLRREIEIQSHLRHPNILRLFGYFYDESRVYLI
LEYAPRGELYKQLQRAGRFDEQRTASYISQLADALKYCHSKKVIHRDIKPENLLLGLLGD
LKIADFGWSVHAPSSRRNTLCGTMDYLPPEMIEGRMHDDKVDLWSLGVLCYEFLVGKPPF
EAEGSTETYRRITKVHYQFPSYVSAGARDVIKRLLQHNPANRLPLEQVLAHPWIVENSKK
KPSSSSTSSSESQS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcttgacttgtttgtgttacgagtgtgtctgtgtggtgatattaaattggtt
tacagtaggcctaggcctagatctagatctagatctaggtctactctaggcctgagtcaa
acattattgataacaaatttatatctttctgctttcatcatgcatgtgcatttgtctttg
caggttgcttcttcactgaatagaggtactacagcccaggccaggacacaacctgtcaaa
tcagcggagaatggccacgggcacgatgacaaacaaatggaaccaaagaaatcatggaca
ttgaaagactttgacatcgggcggccgttgggcaagggcaagttcgggagcgtgtacctg
gcccgcgagaagcagaccaagtacatcgtggccctcaaggtgctcttcaagtcgcagctt
cagaaggctcaagtagaacatcagttgaggagagagattgagattcaatctcatcttagg
catcccaatattctcaggctcttcggctatttctacgatgagagcagagtatacttaatt
ttggaatatgctccaaggggagagctctacaaacagcttcagagagcaggaagattcgat
gagcaaagaactgcttcatacatcagccagctagccgacgccctaaaatactgtcactcc
aagaaggttatccatcgtgatatcaaaccagagaatcttctacttggtctcctaggtgat
cttaagattgcagactttggttggtctgtccatgccccttcctcaagacgaaacacccta
tgcggcaccatggactacctgccacccgagatgattgagggacgcatgcacgacgacaag
gtagacctgtggagtctgggcgtactctgctatgagttcctggtgggcaaacctccattt
gaagcagagggcagcaccgagacctaccgtagaatcacaaaggttcactatcagttccca
agttacgtatcagctggtgccagagacgtgattaaaaggctactccaacataatcccgcc
aacagactcccgctagaacaggtcctggcccatccctggatcgtagagaactctaagaag
aagccctcatcatcctccacttcatcatcagaatcgcaatcatga

DBGET integrated database retrieval system