KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576342Help
Entry
576342            CDS       T01019                                 

Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     576342
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   576342
Protein phosphatases and associated proteins [BR:spu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     576342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 321 aa AA seqDB search
MHVHLSLQVASSLNRGTTAQARTQPVKSAENGHGHDDKQMEPKKSWTLKDFDIGRPLGKG
KFGSVYLAREKQTKYIVALKVLFKSQLQKAQVEHQLRREIEIQSHLRHPNILRLFGYFYD
ESRVYLILEYAPRGELYKQLQRAGRFDEQRTASYISQLADALKYCHSKKVIHRDIKPENL
LLGLLGDLKIADFGWSVHAPSSRRNTLCGTMDYLPPEMIEGRMHDDKVDLWSLGVLCYEF
LVGKPPFEAEGSTETYRRITKVHYQFPSYVSAGARDVIKRLLQHNPANRLPLEQVLAHPW
IVENSKKKPSSSSTSSSESQS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgcatttgtctttgcaggttgcttcttcactgaatagaggtactacagcccag
gccaggacacaacctgtcaaatcagcggagaatggccacgggcacgatgacaaacaaatg
gaaccaaagaaatcatggacattgaaagactttgacatcgggcggccgttgggcaagggc
aagttcgggagcgtgtacctggcccgcgagaagcagaccaagtacatcgtggccctcaag
gtgctcttcaagtcgcagcttcagaaggctcaagtagaacatcagttgaggagagagatt
gagattcaatctcatcttaggcatcccaatattctcaggctcttcggctatttctacgat
gagagcagagtatacttaattttggaatatgctccaaggggagagctctacaaacagctt
cagagagcaggaagattcgatgagcaaagaactgcttcatacatcagccagctagccgac
gccctaaaatactgtcactccaagaaggttatccatcgtgatatcaaaccagagaatctt
ctacttggtctcctaggtgatcttaagattgcagactttggttggtctgtccatgcccct
tcctcaagacgaaacaccctatgcggcaccatggactacctgccacccgagatgattgag
ggacgcatgcacgacgacaaggtagacctgtggagtctgggcgtactctgctatgagttc
ctggtgggcaaacctccatttgaagcagagggcagcaccgagacctaccgtagaatcaca
aaggttcactatcagttcccaagttacgtatcagctggtgccagagacgtgattaaaagg
ctactccaacataatcccgccaacagactcccgctagaacaggtcctggcccatccctgg
atcgtagagaactctaagaagaagccctcatcatcctccacttcatcatcagaatcgcaa
tcatga

DBGET integrated database retrieval system