KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576342Help
Entry
576342            CDS       T01019                                 

Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     576342
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   576342
Protein phosphatases and associated proteins [BR:spu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     576342
Chromosome [BR:spu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    576342
   Spindle formation proteins
    576342
  Sister chromatid separation proteins
   Aurora kinases
    576342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 321 aa AA seqDB search
MHVHLSLQVASSLNRGTTAQARTQPVKSAENGHGHDDKQMEPKKSWTLKDFDIGRPLGKG
KFGSVYLAREKQTKYIVALKVLFKSQLQKAQVEHQLRREIEIQSHLRHPNILRLFGYFYD
ESRVYLILEYAPRGELYKQLQRAGRFDEQRTASYISQLADALKYCHSKKVIHRDIKPENL
LLGLLGDLKIADFGWSVHAPSSRRNTLCGTMDYLPPEMIEGRMHDDKVDLWSLGVLCYEF
LVGKPPFEAEGSTETYRRITKVHYQFPSYVSAGARDVIKRLLQHNPANRLPLEQVLAHPW
IVENSKKKPSSSSTSSSESQS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgcatttgtctttgcaggttgcttcttcactgaatagaggtactacagcccag
gccaggacacaacctgtcaaatcagcggagaatggccacgggcacgatgacaaacaaatg
gaaccaaagaaatcatggacattgaaagactttgacatcgggcggccgttgggcaagggc
aagttcgggagcgtgtacctggcccgcgagaagcagaccaagtacatcgtggccctcaag
gtgctcttcaagtcgcagcttcagaaggctcaagtagaacatcagttgaggagagagatt
gagattcaatctcatcttaggcatcccaatattctcaggctcttcggctatttctacgat
gagagcagagtatacttaattttggaatatgctccaaggggagagctctacaaacagctt
cagagagcaggaagattcgatgagcaaagaactgcttcatacatcagccagctagccgac
gccctaaaatactgtcactccaagaaggttatccatcgtgatatcaaaccagagaatctt
ctacttggtctcctaggtgatcttaagattgcagactttggttggtctgtccatgcccct
tcctcaagacgaaacaccctatgcggcaccatggactacctgccacccgagatgattgag
ggacgcatgcacgacgacaaggtagacctgtggagtctgggcgtactctgctatgagttc
ctggtgggcaaacctccatttgaagcagagggcagcaccgagacctaccgtagaatcaca
aaggttcactatcagttcccaagttacgtatcagctggtgccagagacgtgattaaaagg
ctactccaacataatcccgccaacagactcccgctagaacaggtcctggcccatccctgg
atcgtagagaactctaagaagaagccctcatcatcctccacttcatcatcagaatcgcaa
tcatga

DBGET integrated database retrieval system