KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576455Help
Entry
576455            CDS       T01019                                 

Definition
calcium-binding protein p22-like
Orthology
K17610  
calcineurin B homologous protein 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Protein phosphatases and associated proteins [BR:spu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     576455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 190 aa AA seqDB search
MGSRTSSLLQQEEIEEIQQETGFSPKQIVRLYSRFTNLDKSDRGMLRVEDLYRIPELVIN
PLGERIIQTFFLECESDQINFRQFMKTLGLFRPYKKRYGPEAINTREKKLKFAFQMYDVD
NDGSIARDELLVLLHMMVGSNITEEQLGAIADRTLLEADLDEDGQISFEEFIKALEKSDC
EQMMSIRFLN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgggttccagaacgtcttctctcctgcaacaggaggaaatagaggaaattcagcaagaa
acgggtttttctcccaaacaaattgtccgattgtacagtcgctttacaaacttggataag
agtgacagaggaatgctcagggtggaggatctgtaccgcatcccagagctggtcatcaac
ccgttaggagaacgtatcatccagacattcttcttagagtgtgagtctgatcagatcaac
ttcagacagtttatgaagaccctagggctcttcagaccctacaagaaacgctatggtccg
gaggccatcaacaccagagagaagaaactcaaatttgccttccaaatgtatgatgtggat
aatgatggcagcatagcacgagacgagctgttggtactgctccatatgatggttggatct
aacatcacggaagagcaacttggtgctatcgcagaccgtaccctcttagaagcagacttg
gatgaagatggtcagatctcatttgaagaatttatcaaggcacttgagaagtctgattgt
gaacagatgatgagcattcgcttcctcaactag

DBGET integrated database retrieval system