KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576462Help
Entry
576462            CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 318 aa AA seqDB search
MAGASAGDWCLIESDPGVFTELIRGFGMPVHGLIFLFKWQPGMDSSGTIVQDSRLDDIFF
AKQVINNACATQAILSVLMNCHHGDMTLGNQLKEFKEFTSTFDPTMKGLTISNSEVIKDV
HNSFARQQMFEFDSRQANKDDDVYHFVSYMPIQGRLYELDGLKDGPVDLGRADDGDWLKT
VKPVIEERIRKYSANEIHFNLMALISDRRMIFNKEISRLQNQLKAEELMDTDQSGPVSAD
AIQSELSRYRLLQEDEDRKIKTFKVENVRRKHNYLPLIMELLKILASKGELVPLVKEAKE
KALAKQEKEKQKKATEAR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgcttcggctggagattggtgtctgatcgagagtgatcccggtgtttttaca
gagctgattagaggctttggtatgcctgttcatgggctgatattcttattcaagtggcag
cctggaatggattcatctggaacgatcgttcaagacagcagattagatgacatcttcttt
gctaaacaggtaatcaacaatgcatgtgccacccaagccatcctgagtgttctgatgaac
tgtcaccatggtgatatgacccttggcaaccagctcaaggaattcaaagagttcacttcg
acctttgaccccacaatgaaaggccttactattagtaattcagaagtcatcaaagatgtt
cacaacagctttgcaagacaacagatgtttgagtttgattcgagacaagctaacaaggat
gatgatgtttatcactttgtgagctacatgcccatccagggaaggttgtatgaactggat
ggattgaaagacggcccagtagatctaggaagagccgatgatggagactggctgaaaaca
gtgaaacctgtcatcgaggagagaatacgcaagtatagtgcaaatgagatccacttcaac
ctgatggccctcatctcagacaggagaatgatattcaacaaggaaatcagcagattacaa
aaccaactcaaggcagaggagctgatggatactgaccaatcaggacctgtgtctgctgat
gccatccaatcagagctgagcaggtataggctcttgcaggaagacgaggataggaaaatc
aaaacatttaaggtagagaatgtaagacggaagcacaactacctaccactcatcatggag
ctcctcaagatcttagccagcaaaggagaattagtgcctttagttaaagaggcaaaagag
aaagctctagcaaagcaggagaaggaaaagcagaagaaagcgactgaagcaagataa

DBGET integrated database retrieval system