KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576527Help
Entry
576527            CDS       T01019                                 

Definition
protein unc-13 homolog B-like
Orthology
K15293  
protein unc-13
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2145 aa AA seqDB search
MSLLCVCVKAAYLDGPPEKFNSYVTLKLQNVKSTTVAVKGNQPLWEQDFMFETNQLNVGL
VVELWTKGLIWDTLLGTALVPLRGIKQSSEEGSGEWFSLDREVEVKNRQVNGTKMPTGHR
VLIDARYEVPFEQEESVAYERKLRMIHDIIQQDASGSGQQPPAQLIPAQSGMMSEDSDYT
SDVNAPTVSNSSPRHSGGTAHHSSDRLDSPSHGSPPSRFHDFNDDRFPGMEQPYYPHDLT
DEERIGRFIEDDERRRLYPEDRDDFTDGSADRLDQDFPEREYYNGYHPGSNMDHRYNGST
GEFTNPEDNYSGEYDSEFGPNQRGYLDDYDKFREEYREGQSSDEQRYRPMESYEQEEYDR
KYHREDSPHEVYSDEYEGREREFVHPDREYVAPDREYVAPDREYVPPDGEFEHPGSEDIE
YDKDKGAYDLRKGEDLRIGDREPLPGGRGSSYDLRRDGDLEPLRGSNYDLRTESEYESRR
GNLVPGSGLDSKKGSKYDLTRDTEYDMHRDGEFDLGLESKFDSRRNSGFDSRLDSDFDLR
QGREFDRDPRPEEDFEPEQGRDFELHENIYCPPDTGDDLETRDSDLDARSSEFELVRRDP
YRNLRESDYDHRGSNFGRQTDDFEGYNFDEGRNYVDRGESFETRTEQSEVESETSNTIPS
THRQMEPYPYSPHGSESYLHRDERDVDSLERESRPSLDTGSAGSSRYSSPRVGRSNLTLD
QYSESLQQSDELLDRGDHDLDLELLEEEDELRDLVPAMTIARMRWLNAFHRVREQIKEGY
YDGDSSMRSGRVGGLWANLANGGPPGLDLLPDMLPRRKSIPLEIGVKSLCWSLAVMKRQQ
MPSTMVNRQSLNDEELKSHVYKKTLQALIYPISSTTPHNFEIWTATTPTYCYECEGLLWG
IARQGVRCSECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKTQNIIMAMKDRMKIRER
NKPEIFEMIREVFNTPPQPHSGHMKAVKQSVLDGTSKWSAKLAITVVSAQGLIAKDKTGT
SDPYVTVQVGKVKKRTRTVQQNLNPEWNEKFFFECHNSSDRIKVRVWDEDDDLKSKLMQK
LTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKAVAPY
HVQYTCLHENLFHFLSMKEGGQVKLPSAKGDDAWKIYFDETAQEVVDEFAMRYGIESIYQ
AMTHFSCLSSKYMCSGVPAVMSTLLANINAFYAHTTASSAVSASDRFAASNFGKEKFVRL
LDQLHNSVRIDLNSYRNNFPADTVDRLADLKSMVDLLTSITFFRMKVQEQASPPRAASVV
LGCVKACLQSTYDYIRDNCFELYQREFQPDQPVKQPDPEDPNGPRSLDFWTKMISLIVSV
IEEDKTTYTSVLNQFPNELNVGVLSASMMWCGFAKDMKSALEEHDQQRLCTSAEYMNLHF
KVKWMFNKYVEGVTEYENRTPEYASWFEPFVMQWLRENEELSMEFLHGALERDAKENFQK
SSEHARFSCSVVDVFTQINQSFDIIRRLECPDPEIVNRYMRKFANTVNRVLLAYADIVTE
KFARYCNKEEISLQACILMNNIQQLRVYLEKVFESMGGEKLDAEAADTLKKLQGSLNEVL
DQLSKVFAKRFPNELNVGVLSASMMWCGFAKDMKSALEEHDQQRLCTSAEYMNLHFKVKW
MFNKYVEGVTEYENRTPEYASWFEPFVMQWLRENEELSMEFLHGALERDAKENFQKSSEH
ARFSCSVVDVFTQINQSFDIIRRLECPDPEIVNRYMRKFANTVNRVLLAYADIVTEKFAR
YCNKEEISLQACILMNNIQQLRVYLEKVFESMGGEKLDAEAADTLKKLQGSLNEVLDQLS
KVFAKSSILATLNPALAKLQGHGGETKDVNKEENKNLSPKQCAVLEVALDHIKQYFHGSG
NGLKRNFLEKSPELQSLRYALSLYTQTTDMLIKTFVQTQNQQDQPSGNQSFGELSIQVDL
FTHPGTGEHKVNVKVVACNGLKWNTTSMFRPFVEVYMIGPHLSDKRRKHSTKSKANNWAP
KYNETFQFILGNEDEPISYELHFCVKDYCFAREDHLIGIGVLQLHTIVECGSCACVCTLG
RKLHVNDTGGTILRILSQRTNDEVAREFVRLKSERRSEGGDQGRS
NT seq 6438 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgctatgtgtatgcgtcaaagccgcatacctggatggaccaccagagaaattc
aattcctacgtgacgctcaagctccagaatgtgaagtctacgactgtagcagtgaagggc
aaccagccactgtgggagcaagacttcatgttcgagacaaatcagctgaatgttggattg
gttgttgagctatggactaaaggactgatctgggataccctcttgggtaccgctctggta
cccctccgagggattaaacagtccagtgaggaagggagcggtgaatggttctccctggac
agggaagtagaggtcaagaatcgccaggtgaacggaaccaagatgcccaccggtcaccgc
gtcctcatcgatgccagatatgaagtcccctttgagcaagaagaatcggtggcttatgaa
cgcaagctgcggatgatccatgacattatccaacaagatgccagcggctcaggacagcag
ccacctgcccagcttataccggctcagtctggtatgatgtccgaagacagcgattacacc
agtgatgtcaacgcccccacagtcagcaatagcagccctcgacacagcggtggtacagcc
caccattcctcagataggttagactccccctcccacggctcgcccccttcacgcttccat
gatttcaatgatgaccgcttccccggcatggaacagccttactatccccatgacctcacc
gatgaagagcggataggacgcttcatagaggacgacgagagaagacgactctatcccgag
gaccgcgacgacttcacggacggcagtgccgaccgtttagaccaggacttccccgaaaga
gaatactacaatggctatcacccaggtagcaatatggatcacaggtacaatggatcaaca
ggtgaattcacaaaccccgaggacaattacagcggagaatacgattcggaatttggccca
aaccaacggggctatttggatgattacgataagtttcgggaggaatatcgagaaggacag
agctctgacgagcagaggtacagacccatggagtcatatgaacaagaggaatatgatagg
aagtaccatcgggaggattctccacacgaggtttacagcgatgagtatgaagggagggaa
agggagttcgttcaccccgatcgcgagtatgttgcgccggatcgcgagtatgttgcgccg
gatcgtgagtatgttccgccggacggtgaatttgaacacccgggtagtgaggatatcgag
tatgacaaggacaaaggagcttatgatttgcgcaaaggtgaagatctaaggattggtgat
cgtgaacccttacccgggggaagagggagtagttatgatttaagaagggacggagacctt
gagcctttgagaggtagcaactacgatttaaggacagaaagtgaatatgaaagcagaaga
ggcaacctagtaccaggtagcggtctagattctaaaaagggtagcaagtacgatctaaca
agggacactgaatacgatatgcatagagacggtgagtttgatctaggacttgaaagcaaa
tttgattcgcgaagaaacagcgggtttgattcacgacttgacagtgactttgacctaaga
cagggtagagagtttgaccgagatccaagaccggaagaagactttgaacccgagcagggg
agggactttgaattgcatgaaaacatttactgtccgccggacaccggtgacgaccttgaa
actcgcgatagcgaccttgacgccagaagcagcgagtttgaactggtccgccgggacccg
tacagaaaccttcgggagagtgactacgaccacagggggtccaactttggccgccaaacg
gacgactttgaggggtataactttgacgagggcaggaactatgtggacaggggggagagt
tttgagacgaggactgaacagagcgaggtggaatcagaaacaagcaataccatacctagt
acgcaccggcagatggagccctacccctacagtcctcacgggagtgagagttatctgcac
agagacgagagagatgtagatagtttagaacgagagagtaggccctcgctggacacagga
agcgctggaagtagccgctactcatcaccgagggtcggtcggagcaacctgacccttgac
cagtactcagagagcttacagcagtcggacgagctcctggaccggggggaccacgatctg
gacctggaactgctggaagaggaggacgagttaagagacctagtacctgctatgaccatc
gcacgcatgagatggctcaacgcattccatagagtgcgcgagcaaatcaaagagggatat
tacgatggtgacagtagtatgcggtcaggaagggtaggcggactgtgggccaacttagca
aatggcggccctccaggattagacctcctgccagatatgttacctcgaagaaaatccatc
ccgctggagattggggtcaagagcttgtgttggtcgttagctgttatgaagcggcaacaa
atgccttcgacaatggtcaacaggcagtcattgaatgacgaagaattgaaaagccacgtc
tacaagaagaccctacaagccctgatttatccaatttccagcaccacgccccacaacttc
gagatctggaccgccaccacgcccacctactgctacgagtgtgagggactgctctggggc
atcgcccgccagggggtgcgctgctcagagtgcggggtcaaatgtcacgagaagtgcaaa
gaccttctgaatgccgactgcttacagcgagcggcagagaaaagctccaagcatggtgcc
gaggacaagactcaaaacatcatcatggctatgaaagataggatgaagattcgggaaagg
aacaaaccagaaatatttgagatgattcgggaggttttcaacactccgcctcagccccac
tcagggcacatgaaggcggtcaagcagtcggtgctggacggcacatccaagtggtcagcc
aaacttgccatcactgtggtcagcgctcagggtctcattgccaaggacaagactgggacg
agcgacccctacgtcactgttcaggtgggcaaggtcaagaaacggacgcgcaccgttcag
cagaacctcaaccccgagtggaacgaaaagtttttctttgagtgccacaattcctcagac
aggatcaaggtcagagtatgggatgaagatgatgacctgaagtccaaactcatgcagaag
ttgacgagagagtcagatgactttcttggccagacaatcatcgaagtgaggacattaagc
ggtgaaatggatgtctggtataatctagagaaaagaacagacaaatcagcagtctcgggt
gccatcaggttgcatatatcagtggagataaagggagaggagaaagcagtggccccatac
catgtacaatacacctgtcttcatgagaatctcttccacttcttgagtatgaaggaaggg
ggccaggtaaagcttccatcggccaagggcgatgatgcctggaagatttactttgacgag
acggcccaggaagtggtggatgagtttgccatgagatacggcatcgagtccatctaccaa
gccatgacacacttttcctgtctttcatctaagtacatgtgctcaggcgtacccgccgtt
atgagtacattactagccaatatcaatgccttctacgcacacaccacagcatcctctgcg
gtctctgccagtgacagattcgcagcctccaacttcgggaaagagaagtttgtacgcctt
ctcgatcaacttcacaattcagtccggatagatctcaattcatacagaaataacttccct
gctgataccgtagacagactagctgatctcaaatccatggtggacctcttaaccagtatt
acattcttcagaatgaaggtgcaagagcaagccagtccacctagagctgcctcagtggtc
ctagggtgcgtcaaggcctgtctacaatccacctacgactacatcagggataactgcttt
gagctgtaccaacgagagttccaaccggatcaacccgtcaagcagcccgacccggaagac
cccaacgggccacgcagcctcgacttctggaccaagatgatatccctcatcgtctctgtc
atagaagaagacaagactacctacacctcagtgctcaaccagtttcccaatgagctgaac
gtgggtgtactatcagctagcatgatgtggtgtggctttgccaaagatatgaagtctgct
cttgaagagcatgaccagcagaggttatgtacgagtgcagaatacatgaaccttcatttc
aaggtgaagtggatgttcaacaagtacgtggaaggagtcactgaatacgagaacaggaca
ccagagtatgccagctggtttgagccgttcgtcatgcagtggctgcgtgagaacgaggaa
ctgtccatggagttcctgcatggcgccctcgagagggacgccaaggagaacttccagaag
agctccgagcatgctcgattctcttgctccgtggttgatgtcttcacccagatcaaccag
agctttgatatcattcgtcgtctcgagtgcccggacccggagatcgtcaatagatacatg
aggaaatttgcaaatactgtcaacagagtattacttgcctatgcagacattgtcactgag
aagtttgcccgctactgcaacaaggaagaaatatccctccaagcctgcatcctcatgaac
aacatccagcagctcagggtatacctggagaaggtatttgagtcgatgggaggagagaag
ctagacgcagaggctgcagacactttgaagaagctccagggcagcctcaacgaagtctta
gaccaactcagcaaagttttcgcaaagaggtttcccaatgagctgaacgtgggtgtacta
tcagctagcatgatgtggtgtggctttgccaaagatatgaagtctgctcttgaagagcat
gaccagcagaggttatgtacgagtgcagaatacatgaaccttcatttcaaggtgaagtgg
atgttcaacaagtacgtggaaggagtcactgaatacgagaacaggacaccagagtatgcc
agctggtttgagccgttcgtcatgcagtggctgcgtgagaacgaggaactgtccatggag
ttcctgcatggcgccctcgagagggacgccaaggagaacttccagaagagctccgagcat
gctcgattctcttgctccgtggttgatgtcttcacccagatcaaccagagctttgatatc
attcgtcgtctcgagtgcccggacccggagatcgtcaatagatacatgaggaaatttgca
aatactgtcaacagagtattacttgcctatgcagacattgtcactgagaagtttgcccgc
tactgcaacaaggaagaaatatccctccaagcctgcatcctcatgaacaacatccagcag
ctcagggtatacctggagaaggtatttgagtcgatgggaggagagaagctagacgcagag
gctgcagacactttgaagaagctccagggcagcctcaacgaagtcttagaccaactcagc
aaagttttcgccaagagttcaattcttgccacactcaacccagcattagccaaactgcag
gggcatggcggagaaaccaaggacgtgaacaaggaagaaaacaagaacctgtcccccaaa
caatgtgccgttttagaagttgctcttgatcatatcaagcaatacttccatggctccggc
aatggcctcaagcgcaactttctggagaagagtccggagcttcagtcgttgcggtacgcc
ctctctctctacacccagaccaccgacatgcttatcaagacctttgtccagacgcagaat
caacaagatcaaccaagtggcaaccagtcgtttggtgagctctccatccaggtcgacctc
ttcacccatcctggcacaggggaacacaaggtcaatgtcaaagtggttgcctgcaatgga
ttgaaatggaacacgacaagtatgttccgaccgtttgtagaagtctacatgattggacca
catctcagcgataaaagacgcaaacattccaccaagtccaaggccaacaactgggcaccc
aaatacaacgagaccttccaattcatcctaggtaacgaggatgagcccatctcttatgag
cttcacttctgcgtgaaggactactgcttcgccagggaagaccacctcatcgggattggc
gtacttcagctccacaccatcgtggaatgcggcagctgtgcctgcgtgtgtacgttagga
cgcaagctgcacgtcaacgacacgggtgggactatcttacgcatcctatcccagcgaacg
aatgacgaggtggcgcgggagttcgttcgactcaagtcagagaggagatcggagggtggc
gatcagggaagaagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system