KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576527Help
Entry
576527            CDS       T01019                                 

Definition
(RefSeq) protein unc-13 homolog B
  KO
K15293  
protein unc-13 A/B/C
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1677 aa AA seqDB search
MFETNQLNVGLVVELWTKGLIWDTLLGTALVPLRGIKQSSEEGSGEWFSLDREVEVKNRQ
VNGTKMPTGHRVLIDARYEVPFASASTAKEQEESVAYERKLRMIHDIIQQDASGSGQQPP
AQLIPAQSGMMSEDSDYTSDVNAPTVSNSSPRHSGGTAHHSSDRLDSPSHGSPPSRFHDF
NDDRFPGMEQPYYPHDLTDEERIGRFIEDDERRRLYPEDRDDFTDGSADRLDQDFPEREY
YNGYHPGSNMDHRYNGSTGEFTNPEDNYSGEYDSEFGPNQRGYLDDYDKFREEYREGQSS
DEQRYRPMESYEQEEYDRKYHREDSPHEVYSDEYEGREREFVHPDREYVAPDREYVAPDR
EYVPPDGEFEHPGSEDIEYDKDKGAYDLRKGEDLRIGDREPLPGGRGSSYDLRRDGDLEP
LRGSNYDLRTESEYESRRGNLVPGSGLDSKKGSKYDLTRDTEYDMHRDGEFDLGLESKFD
SRRNSGFDSRLDSDFDLRQGREFDRDPRPEEDFEPEQGRDFELHENIYCPPDTGDDLETR
DSDLDARSSEFELVRRDPYRNLRESDYDHRGSNFGRQTDDFEGYNFDEGRNYVDRGESFE
TRTEQSEVESETSNTIPSTHRQMEPYPYSPHGSESYLHRDERDVDSLERESRPSLDTGSA
GSSRYSSPRVGRSNLTLDQYSESLQQSDELLDRGDHDLDLELLEEEDELRDLVPAMTIAR
MRWLNAFHRVREQIKEGYYDGDSSMRSGRVGGLWANLANGGPPGLDLLPDMLPRRKSIPL
EIGVKSLCWSLAVMKRQQMPSTMVNRQSLNDEELKSHVYKKTLQALIYPISSTTPHNFEI
WTATTPTYCYECEGLLWGIARQGVRCSECGVKCHEKCKDLLNADCLQLFMTKKSTCETID
ESQPCWLVRAIHHLAMLPAILFGKGDLAEKEAEHRQEDRCDIVMVINDEEDEEEEDVVVI
ETMEEEFEDAENCVDDGAAEKSSKHGAEDKTQNIIMAMKDRMKIRERNKPEIFEMIREVF
NTPPQPHSGHMKAVKQSVLDGTSKWSAKLAITVVSAQGLIAKDKTGTSDPYVTVQVGKVK
KRTRTVQQNLNPEWNEKFFFECHNSSDRIKVRVWDEDDDLKSKLMQKLTRESDDFLGQTI
IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKAVAPYHVQYTCLHENLFH
FLSMKEGGQVKLPSAKGDDAWKIYFDETAQEVVDEFAMRYGIESIYQAMTHFSCLSSKYM
CSGVPAVMSTLLANINAFYAHTTASSAVSASDRFAASNFGKEKFVRLLDQLHNSVRIDLN
SYRNNFPADTVDRLADLKSMVDLLTSITFFRMKVQEQASPPRAASVVLGCVKACLQSTYD
YIRDNCFELYQREFQPDQPVKQPDPEDPNGPRSLDFWTKMISLIVSVIEEDKTTYTSVLN
QFPNELNVGVLSASMMWCGFAKDMKSALEEHDQQRLCTSAEYMNLHFKVKWMFNKYVEGV
TEYENRTPEYASWFEPFVMQWLRENEELSMEFLHGALERDAKENFQKSSEHARFSCSVVD
VFTQINQSFDIIRRLECPDPEIVNRYMRKFANTVNRVLLAYADIVTEKFARYCNKEEISL
QACILMNNIQQLRVYLEKVFESMGGEKLDAEAADTLKKLQGSLNEVLDQLSKVFAKR
NT seq 5034 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagacaaatcagctgaatgttggattggttgttgagctatggactaaaggactg
atctgggataccctcttgggtaccgctctggtacccctccgagggattaaacagtccagt
gaggaagggagcggtgaatggttctccctggacagggaagtagaggtcaagaatcgccag
gtgaacggaaccaagatgcccaccggtcaccgcgtcctcatcgatgccagatatgaagtc
ccctttgcatcagcttcaacggctaaagagcaagaagaatcggtggcttatgaacgcaag
ctgcggatgatccatgacattatccaacaagatgccagcggctcaggacagcagccacct
gcccagcttataccggctcagtctggtatgatgtccgaagacagcgattacaccagtgat
gtcaacgcccccacagtcagcaatagcagccctcgacacagcggtggtacagcccaccat
tcctcagataggttagactccccctcccacggctcgcccccttcacgcttccatgatttc
aatgatgaccgcttccccggcatggaacagccttactatccccatgacctcaccgatgaa
gagcggataggacgcttcatagaggacgacgagagaagacgactctatcccgaggaccgc
gacgacttcacggacggcagtgccgaccgtttagaccaggacttccccgaaagagaatac
tacaatggctatcacccaggtagcaatatggatcacaggtacaatggatcaacaggtgaa
ttcacaaaccccgaggacaattacagcggagaatacgattcggaatttggcccaaaccaa
cggggctatttggatgattacgataagtttcgggaggaatatcgagaaggacagagctct
gacgagcagaggtacagacccatggagtcatatgaacaagaggaatatgataggaagtac
catcgggaggattctccacacgaggtttacagcgatgagtatgaagggagggaaagggag
ttcgttcaccccgatcgcgagtatgttgcgccggatcgcgagtatgttgcgccggatcgt
gagtatgttccgccggacggtgaatttgaacacccgggtagtgaggatatcgagtatgac
aaggacaaaggagcttatgatttgcgcaaaggtgaagatctaaggattggtgatcgtgaa
cccttacccgggggaagagggagtagttatgatttaagaagggacggagaccttgagcct
ttgagaggtagcaactacgatttaaggacagaaagtgaatatgaaagcagaagaggcaac
ctagtaccaggtagcggtctagattctaaaaagggtagcaagtacgatctaacaagggac
actgaatacgatatgcatagagacggtgagtttgatctaggacttgaaagcaaatttgat
tcgcgaagaaacagcgggtttgattcacgacttgacagtgactttgacctaagacagggt
agagagtttgaccgagatccaagaccggaagaagactttgaacccgagcaggggagggac
tttgaattgcatgaaaacatttactgtccgccggacaccggtgacgaccttgaaactcgc
gatagcgaccttgacgccagaagcagcgagtttgaactggtccgccgggacccgtacaga
aaccttcgggagagtgactacgaccacagggggtccaactttggccgccaaacggacgac
tttgaggggtataactttgacgagggcaggaactatgtggacaggggggagagttttgag
acgaggactgaacagagcgaggtggaatcagaaacaagcaataccatacctagtacgcac
cggcagatggagccctacccctacagtcctcacgggagtgagagttatctgcacagagac
gagagagatgtagatagtttagaacgagagagtaggccctcgctggacacaggaagcgct
ggaagtagccgctactcatcaccgagggtcggtcggagcaacctgacccttgaccagtac
tcagagagcttacagcagtcggacgagctcctggaccggggggaccacgatctggacctg
gaactgctggaagaggaggacgagttaagagacctagtacctgctatgaccatcgcacgc
atgagatggctcaacgcattccatagagtgcgcgagcaaatcaaagagggatattacgat
ggtgacagtagtatgcggtcaggaagggtaggcggactgtgggccaacttagcaaatggc
ggccctccaggattagacctcctgccagatatgttacctcgaagaaaatccatcccgctg
gagattggggtcaagagcttgtgttggtcgttagctgttatgaagcggcaacaaatgcct
tcgacaatggtcaacaggcagtcattgaatgacgaagaattgaaaagccacgtctacaag
aagaccctacaagccctgatttatccaatttccagcaccacgccccacaacttcgagatc
tggaccgccaccacgcccacctactgctacgagtgtgagggactgctctggggcatcgcc
cgccagggggtgcgctgctcagagtgcggggtcaaatgtcacgagaagtgcaaagacctt
ctgaatgccgactgcttacagcttttcatgacaaagaagagcacgtgcgagacgattgac
gaatcacagccatgttggttagtccgtgctattcaccacctcgctatgcttcccgccata
ctcttcgggaagggcgacttagccgagaaagaagcggaacaccgtcaagaagatcgttgt
gacatagtcatggtcattaatgacgaggaagatgaggaggaggaggatgtggttgtcatt
gagacaatggaagaggaatttgaagatgcggagaattgtgtcgacgatggagcggcagag
aaaagctccaagcatggtgccgaggacaagactcaaaacatcatcatggctatgaaagat
aggatgaagattcgggaaaggaacaaaccagaaatatttgagatgattcgggaggttttc
aacactccgcctcagccccactcagggcacatgaaggcggtcaagcagtcggtgctggac
ggcacatccaagtggtcagccaaacttgccatcactgtggtcagcgctcagggtctcatt
gccaaggacaagactgggacgagcgacccctacgtcactgttcaggtgggcaaggtcaag
aaacggacgcgcaccgttcagcagaacctcaaccccgagtggaacgaaaagtttttcttt
gagtgccacaattcctcagacaggatcaaggtcagagtatgggatgaagatgatgacctg
aagtccaaactcatgcagaagttgacgagagagtcagatgactttcttggccagacaatc
atcgaagtgaggacattaagcggtgaaatggatgtctggtataatctagagaaaagaaca
gacaaatcagcagtctcgggtgccatcaggttgcatatatcagtggagataaagggagag
gagaaagcagtggccccataccatgtacaatacacctgtcttcatgagaatctcttccac
ttcttgagtatgaaggaagggggccaggtaaagcttccatcggccaagggcgatgatgcc
tggaagatttactttgacgagacggcccaggaagtggtggatgagtttgccatgagatac
ggcatcgagtccatctaccaagccatgacacacttttcctgtctttcatctaagtacatg
tgctcaggcgtacccgccgttatgagtacattactagccaatatcaatgccttctacgca
cacaccacagcatcctctgcggtctctgccagtgacagattcgcagcctccaacttcggg
aaagagaagtttgtacgccttctcgatcaacttcacaattcagtccggatagatctcaat
tcatacagaaataacttccctgctgataccgtagacagactagctgatctcaaatccatg
gtggacctcttaaccagtattacattcttcagaatgaaggtgcaagagcaagccagtcca
cctagagctgcctcagtggtcctagggtgcgtcaaggcctgtctacaatccacctacgac
tacatcagggataactgctttgagctgtaccaacgagagttccaaccggatcaacccgtc
aagcagcccgacccggaagaccccaacgggccacgcagcctcgacttctggaccaagatg
atatccctcatcgtctctgtcatagaagaagacaagactacctacacctcagtgctcaac
cagtttcccaatgagctgaacgtgggtgtactatcagctagcatgatgtggtgtggcttt
gccaaagatatgaagtctgctcttgaagagcatgaccagcagaggttatgtacgagtgca
gaatacatgaaccttcatttcaaggtgaagtggatgttcaacaagtacgtggaaggagtc
actgaatacgagaacaggacaccagagtatgccagctggtttgagccgttcgtcatgcag
tggctgcgtgagaacgaggaactgtccatggagttcctgcatggcgccctcgagagggac
gccaaggagaacttccagaagagctccgagcatgctcgattctcttgctccgtggttgat
gtcttcacccagatcaaccagagctttgatatcattcgtcgtctcgagtgcccggacccg
gagatcgtcaatagatacatgaggaaatttgcaaatactgtcaacagagtattacttgcc
tatgcagacattgtcactgagaagtttgcccgctactgcaacaaggaagaaatatccctc
caagcctgcatcctcatgaacaacatccagcagctcagggtatacctggagaaggtattt
gagtcgatgggaggagagaagctagacgcagaggctgcagacactttgaagaagctccag
ggcagcctcaacgaagtcttagaccaactcagcaaagttttcgcaaagaggtaa

DBGET integrated database retrieval system