KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576669Help
Entry
576669            CDS       T01019                                 

Gene name
thbs3
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  
thrombospondin 2/3/4/5
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    576669 (thbs3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    576669 (thbs3)
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   576669 (thbs3)
  Exosomal proteins of colorectal cancer cells
   576669 (thbs3)
  Exosomal proteins of bladder cancer cells
   576669 (thbs3)
Glycosaminoglycan binding proteins [BR:spu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   576669 (thbs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 963 aa AA seqDB search
MQFGTCSIAFLLMLSVTSSQIPVSMGVEADLFDGFGIYNSRIPGVSPAPQENSNIYGDAF
FFNGISIRYPIIANQEFFKKFAKEMRKNEDVYFVIRSRLAPRHHGVLFGVYSSNYYSQDT
FRTPLRFELSYNGTNGGKLVLKYRVGDQQRQAEFPNLLVVDGDWHTIILQFHTERSSTTL
TLYVDCRLANQMKIGDKLSRVFSRTVIDGSEMRLGQAGYGMTANPLKGTIQNVRFMYGGP
IGDVLHSLSCSLSTEPKPLDADGWPGATILMDAFQSLSSTLMVLKNGMDDQTREIRHLRN
TLENCRMCERTDYFTSGPQTIITHGCSSNPCFPDVMCFDEPDGLGYRCGPCPAGYRGNGS
YCYDINECIEAYPCSDVVECINLVPGFRCPPCPEGFIGLGLEGIGLEAAVRNRQVCDDIN
ECERNNGDCVPNSYCINTRGSHICGDCKHGFEGNQTVGCKQKNTCPNGERSPCHPKAKCI
IHRNNAYTCECIIGWAGDGYDCALDTDLDGYPDYALPCTDKHCRADNCVYIPNSGQENQD
GDEMGDICDPDADNDGVPNGPDNCPLVANPDQVNSQDDDPVGERCDNCPMTPNPKQIDTD
ADGKGDECDDDKDNDGILNIYDNCELVPNRMQDDTDGDGLGDACDNCPMQYNPDQNNTDS
DLLGDICDNNEDSDDDGIQDNLDNCPKIPNNPQLDSDGDGRGDACDDDDDSDGVYDIVDN
CRIIHNPDQADYNQDGIGDMCDSDFDRDGVDDQYDACPENPNIFTTDLRTYQTVVLDPEG
EAQVDPKWIVFDEGRQIMQTINSDPGLAISYQAFDGVDFEGTFFVNTRTDDDFAGFVFGY
QDSASFYVLMWKQGPQTYWEASPFRAVGEPGFQLKSRLLWKDPNNHGWKDHVAYRWRVVH
RPSIGLIRVKLYEADSLVADSGFLRDTTMRGGRIGLFCFSQEDIIWARITYKCNDDIPEG
VTF
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcggcacgtgttccatcgccttccttctgatgctatccgtgacgtcatcgcag
ataccagtctctatgggcgtcgaagcggatcttttcgacggcttcggcatctacaactcc
cgaatccccggggtctcacccgccccgcaggagaactctaacatctacggcgatgccttc
ttcttcaacggcataagcattcgttatcccatcatcgccaaccaagaattcttcaagaag
ttcgctaaggagatgcggaagaatgaggatgtatacttcgtgattcgatcacggcttgct
cctcggcatcatggagtcttattcggagtgtactcgagtaattactactcacaggacacc
ttcagaacgccacttaggtttgagctgtcctacaatggcacaaatggaggaaaattggtc
ctcaaataccgcgtcggagatcagcaacgccaggcggagttccccaacctcctcgtggtt
gacggtgattggcacaccattatcctccagttccacaccgaacgatccagcacgaccctc
acactctatgtcgactgccggctcgctaatcagatgaagataggggataagttatccagg
gtcttctctcgaacggtgatcgacggttcagagatgaggctgggtcaggctggttacggc
atgactgcaaacccactgaagggtacgattcagaatgttaggttcatgtatggaggtcca
ataggagatgtgctccactcactctcatgcagtctgtctacggaacctaagccacttgat
gctgatggatggcctggagcgactattttgatggacgcctttcaatccttgtctagtaca
ctcatggtcttgaaaaacggcatggatgaccagacccgtgagatccgacatctaaggaat
accctcgaaaactgcagaatgtgtgagcgaaccgattattttacctcaggtcctcagaca
atcatcacacatgggtgtagctcgaatccttgcttccccgatgttatgtgctttgatgag
cccgatggtctgggatacaggtgcggtccttgccccgctggctaccgaggaaacggctcc
tactgttacgatatcaacgagtgtattgaagcttacccgtgttcagacgtagtagagtgt
atcaacctagtcccagggttccgctgtccaccatgtcctgaaggattcatcggtcttgga
ttagaaggaatcggtcttgaagctgctgttaggaacagacaggtttgcgatgatatcaat
gagtgcgaaagaaacaatggtgactgcgtgccaaactcttactgcatcaacacaaggggt
tcacacatctgcggtgactgcaagcacgggtttgaaggcaaccaaacggttggatgtaag
cagaagaatacatgtcctaatggagaacgcagtccctgtcaccccaaggctaaatgcatc
atacacaggaataacgcttatacgtgcgagtgtatcattgggtgggccggtgacggctac
gattgcgctcttgataccgatctggacggctatcctgattacgctcttccatgtaccgac
aagcattgcagagctgacaattgcgtatatattcctaatagcggacaggagaatcaagat
ggcgacgaaatgggtgacatttgtgacccggatgcagacaatgatggagttcctaatggt
ccggataactgccctctggtggcgaaccctgatcaagtgaatagccaagacgatgacccg
gtgggcgaaagatgtgataactgtccgatgacgcctaaccccaagcagattgataccgat
gcagacggcaagggtgacgagtgcgacgacgataaggacaatgatggtatcctaaacatc
tacgataactgtgaacttgttccgaacaggatgcaagatgatactgatggggatggtctc
ggtgacgcttgtgataactgtcccatgcaatacaatccagaccagaataacacggattct
gatttgcttggagatatttgcgataacaatgaggattcggacgacgatggtattcaggac
aacttggacaactgccccaaaatcccaaacaaccctcagctagactccgacggtgatggc
aggggtgatgcatgcgacgacgatgacgacagcgacggtgtttacgacatcgtagacaac
tgtaggatcattcataaccctgaccaagcagattataatcaggatggcatcggtgatatg
tgcgacagtgatttcgatcgtgacggcgtggatgatcaatatgatgcctgtcctgagaac
cctaatatattcaccaccgatctcagaacctatcagactgtggtcctagatccagagggt
gaagctcaagtcgatcctaagtggattgtctttgacgagggtcgtcagatcatgcaaacc
atcaacagcgatcccggcttagccatctcttaccaagccttcgacggtgtggacttcgaa
ggaaccttctttgtgaacacccgaactgatgatgacttcgcaggttttgtctttggttac
caggattcggctagtttctacgtcctgatgtggaagcagggtccacagacctattgggaa
gcttccccattcagggccgtcggtgaaccgggcttccaacttaagtcacgtcttctgtgg
aaggacccgaataaccatggttggaaggatcacgtggcctacaggtggagagtcgtccac
aggccttcgataggtctcatcagggtaaagctgtacgaagcagacagtctggtagcggac
tctgggttcctccgagacacaacgatgagaggtggaaggatcggtctgttctgcttctca
caagaagatatcatctgggccagaataacctacaaatgtaatgatgatataccggagggt
gttaccttctga

DBGET integrated database retrieval system