KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576717Help
Entry
576717            CDS       T01019                                 

Definition
protein disulfide-isomerase A5-like
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     576717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 326 aa AA seqDB search
KGKRKFDFGGCGHCKKMKPEYVEAAAELKENGLEGVMGAVDATKARALAERFEVKGFPTL
KYFKNGEHAWDLNERTADKFVEHLTDPQEPPPPPPPEPSWSDSESEVDHLTDDNFKSFTK
KKKHTLVMFYAPWCGHCKKAKPEYMGAAEEFKEENKVSYAAIDCTEHKDSCTAFGVTGYP
TIKYFSYGKLVQDYTSGREEADFIRFMHNQLSPGSAPSEPPPPPPDVNFWAELDGGENVF
QIDDSIFESFLTSSPSVLIMFYAPWCGHCKRMKPAFAEAATLAKEQNLPGRFAAVDATVA
VMTASAFEVKGFPTREYKASTFVSLV
NT seq 982 nt NT seq  +upstreamnt  +downstreamnt
gaaaggaaagaggaagtttgactttggcgggtgtggtcactgcaagaagatgaagcctga
atatgtagaagcagcagcagagctcaaggagaatgggctggagggagttatgggtgctgt
ggatgcaacaaaggccagagctttggctgagagatttgaagtcaaaggattcccaactct
caaatatttcaagaatggagagcatgcatgggacttgaatgagaggacggcagacaagtt
tgtggaacatttaacagatccacaggagcctcctccacccccaccccctgaaccatcatg
gagtgactcagaatctgaagtggaccatcttaccgatgataactttaaatctttcaccaa
gaagaagaagcataccctagtcatgttttatgcaccatggtgtggacattgtaagaaagc
caaaccagaatatatgggagcagctgaggaatttaaggaagaaaataaagtttcctatgc
tgcaatagactgcacagagcacaaggattcttgtacagcctttggtgtaacaggataccc
taccatcaagtatttcagctacggcaaactggtacaggactacaccagcggaagagagga
agcagatttcatacgcttcatgcacaaccagttgagccctggctctgcccccagcgagcc
cccaccccctccaccggatgtaaacttctgggcggagctggacggaggagagaatgtatt
ccagattgacgactccatttttgagagcttcctgacttccagcccatctgttttgattat
gttctatgctccatggtgtggacattgtaagagaatgaaaccagcatttgcagaggcagc
aactttagctaaagagcaaaatctaccaggaaggtttgcagctgttgatgctactgttgc
tgtaatgacggcatcagcctttgaagttaaaggattcccaacccgtgagtataaagcatc
aacttttgtcagcttggtttga

DBGET integrated database retrieval system