KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576855Help
Entry
576855            CDS       T01019                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    576855
   00052 Galactose metabolism
    576855
   00500 Starch and sucrose metabolism
    576855
   00520 Amino sugar and nucleotide sugar metabolism
    576855
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     576855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 516 aa AA seqDB search
MPFGQDGDAYASLLMNQGSGLKRSPSQKEFQSQARRDAERHLALEMDKLLDTCPEESRPA
IGKQFEGYKQLFAQFLEEAGTAAAVDWDDILPPPADAVIPYNQLPNYDPALAREYLDKLV
VIKLNGGLGTSMGCQGPKSVISVRNELTFLDLTVRQIEHLNKTYGCDVPLVLMNSFNTDE
DTSKVLRKYGNINIKIHTFQQSRYPRINKESLLPIAKTAVVNGDNIENWYPPGHGDIYES
FSNSGLLDTFIKQGKEYLFLANIDNQGATVDLRILTLLMNEKNREMVMELTDKTRADVKG
GTLIQYHDKLRLLEIAQVPKWHVDDFKSVSKFKIFNTNNLWIKLDAIKRVVENKSLSMEI
IVNNKTLDNGLNVIQLERAVGAAMQNFDNPLGVNVPRSRFLPVKKTQDLLLIMSNLYLLK
SGTLGMSPLRQFPSTPIIKLGTHFDKVRDFLKRFASIPNLLELDHLTVSGDVTFGKGVVL
KGTVIIIANHGERIDIPPGAILENKIVSGNLRILDH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccatttggacaggacggagatgcctatgcatcattgcttatgaaccagggaagtgga
ctgaagcgtagtccaagtcagaaagagttccagtcccaggcaaggagagatgcagaacgt
cacttagccctggagatggacaagttattagatacctgtcctgaagaaagtagacccgcg
atagggaaacagtttgagggatacaaacaattgtttgctcagtttcttgaggaggctggt
acagcagcagccgttgattgggatgacattctaccaccaccagcagatgctgtgatcccg
tacaatcagcttcctaactatgaccctgctctggcccgtgaatacttggacaaactggta
gtgatcaagctgaatggtggtctgggtaccagtatgggatgccaaggtccaaagagtgtc
atcagtgtcagaaatgaacttaccttcctggacttaaccgtccgccaaattgagcacctg
aataaaacatatggctgcgacgtaccattagtattgatgaactccttcaacacagatgag
gacacaagtaaggtcttgcgcaagtacggcaacatcaacatcaaaatccataccttccaa
caaagcaggtatccacgaatcaacaaagaatcgcttctacccatcgccaaaactgctgtg
gtcaatggagacaatattgaaaattggtaccctcctggtcatggggatatctacgagtcc
ttctctaactccggcttgctggacacctttatcaaacagggaaaggagtaccttttcctt
gctaacattgacaaccagggagctactgttgaccttcgcatcctaacattattgatgaat
gagaagaacagagaaatggtgatggaattaactgacaagacaagggctgatgtcaaggga
ggtaccttgatccagtatcacgacaaattgagattgcttgagatagcccaagtaccaaaa
tggcatgttgacgattttaaatccgtctccaaattcaagatcttcaataccaacaatcta
tggatcaagctggatgccattaaacgtgttgttgaaaataaatccctttcaatggagatc
atcgtcaataataagaccctcgataatggcttgaatgtaatccagctagagagagctgtc
ggagctgccatgcaaaactttgataatccacttggtgtcaatgttcccaggagtcgtttc
ctgccagtcaagaagactcaggatcttttgctgatcatgtcgaacctctatcttctcaag
tctggtaccctggggatgagtcccttgagacagttccctagtacacccatcatcaaacta
ggcacccattttgacaaggtacgagatttcttgaagagatttgcaagtattcccaacctc
ttagagttggatcacctgactgtgtcaggagatgtcaccttcggcaaaggtgttgtactc
aaagggacagtgataatcatcgccaatcatggagagagaattgatatcccaccgggagcc
atactggaaaacaagatagtctctggaaatctaagaatcttagatcattga

DBGET integrated database retrieval system