KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576866Help
Entry
576866            CDS       T01019                                 

Definition
serine/threonine-protein kinase TNNI3K-like
Orthology
K17535  
serine/threonine-protein kinase TNNI3K [EC:2.7.11.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 840 aa AA seqDB search
MGAYKSRPTSSCAEEWHKKISESYAVLETRMKEDLDPKDIEQYTGIQKACCSGDTDRVLE
LADERCVVTKTETGLTLLHLSCISTGSKPFVKLLVHAGARVSSLSRNGFSPLHLACFQGD
VDLVKDLLLEEADPTVIGYSSVTALHIASLNGNEEIVEHLIKCGANIHARDTVKFTPLHI
ACYFGHEKVVKCLINHGADINLSGEVGDVPLHLTCVKGHQSITELLVKGRRNNKADVNAQ
DNEQHMPLHFSCRAGHLTTVDYLLQPNLGTKAHEVNIYGDTPLHLACYTGRLDIVKSLIT
KTGPTSLLVENIFSEAPLHSACTYGKNIELVKYLLSQEGVNINTQGRDGHTALHSACYHG
HYHLVQLLLDQGADMNLVATEQNGDSEKDQEQTCLVWAYQRGHDAIVTLLKHHKRPQDES
ACGDYSQPGGDGSYVSVPSPLGRLRCITKEKINVLQLRASLPKNFHLDINEIEFLETIGS
GSFGNVYKGYCRGKIVAIKRYRSSAFSAKSDVDMFCREVSILCRLDSPYVIRFVGACIED
PSHFAIVTQYVAGGSLFSLLHVQKRNIDLQSKMTIAVDVAHGMDYLHNLPHPIIHRDLNS
HNILLDEFGHAEVADFGESRFVKSMHEDNMTKQPGNLRWMAPEVFSQNTQYSIKADIFSY
ALCIWELLSGELPFAHLKPAAAAAEMAYRSTRPPIAITIPKSIVNILQMMWSPNPEERPT
FAQIIPMLDDCRQEFLAVSKTLSGVLSMLDADWATPIDDSEDGLEMGYSGLEPSPSDLEP
GELPAGNVTALRTQWEMCAKSLSGEKNGSSVFPATDKNGYVSDPLSTLRVNDSPILPQQD
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcttacaagtcacgacccacttcttcctgtgcagaggaatggcataagaagatc
agtgaaagctatgccgtgctggaaactcgaatgaaagaggatctcgatcccaaagacatt
gagcaatacacagggatccagaaggcatgctgttctggtgatacagacagggtacttgag
ctagctgatgagagatgtgtggtcactaaaacagagactggactcactcttttacatctc
agctgtatatcaacagggtcgaaaccgtttgtgaagttgttagtccatgctggagccagg
gtcagtagtctgagtaggaatggcttctcaccattgcatctagcttgctttcagggtgat
gtagacctggtgaaggacttactgttagaggaagcagaccctacagtgattggttacagc
tcagttactgccctgcatattgcaagcttgaatggaaatgaagagattgtggaacatctg
attaagtgtggagcaaacattcatgccagagacacagtcaagttcaccccgctccatata
gcatgttactttggccatgaaaaggttgtcaaatgtcttataaaccacggtgctgacatc
aacctgtctggtgaggtcggtgatgtgccccttcatttgacctgtgtcaaaggtcaccag
agcatcacagagcttctggtcaaaggtcgtcgcaataacaaggctgatgtgaatgctcaa
gacaatgagcagcatatgccgctccacttcagttgccgagcaggtcacctgaccacagtc
gattatcttcttcagcctaacctaggcaccaaagcccatgaagttaatatatacggggat
acacccttacacctagcatgctacacagggagactggatattgtcaagtcattaatcaca
aagacaggacctaccagtctgctggtggagaatatatttagtgaagcacctctacacagc
gcatgtacgtacggcaagaatatagagcttgtgaagtatctgttgagtcaggaaggtgtg
aacatcaacacgcaaggcagagacggacacacagctcttcacagtgcctgttaccatggg
cactaccatttagtccagcttctattagaccaaggggcagacatgaatctagtcgctacg
gagcagaatggggactctgagaaagaccaggaacagacctgcttagtctgggcttaccaa
agaggtcatgatgccattgtgacgttactgaagcatcacaaaagaccccaagatgagtct
gcttgtggagactactcacagccaggtggagatggttcctatgtgtctgttccatctccc
ttgggcagactacgatgtattacaaaagagaaaataaatgtgttacaactgagagcatcg
ctacccaagaactttcatctggacattaatgagatagaattccttgaaacaattgggagt
ggatcctttgggaatgtgtacaaaggctactgcagaggaaaaattgtggcaattaagaga
tatcgttccagtgctttcagcgccaagtcagatgtggatatgttctgtcgtgaggtgtcc
atactatgcagactagacagcccctatgtgatacgctttgttggagcttgtatagaggac
cctagccattttgcaattgtgacacagtatgtggcagggggctctctgttttcgttgctt
catgttcaaaagagaaacattgatctccaatccaagatgacgattgctgtggatgtagca
catggcatggactacctgcacaatctgccacaccctatcatacatagagatctaaacagc
cacaatattctccttgatgagtttggacatgccgaagtagcagattttggtgaatccaga
ttcgtcaagtccatgcatgaagacaacatgaccaaacaaccaggaaatcttcgctggatg
gcgccggaagtcttctcccagaacacccagtacagcatcaaggcagacatcttcagctat
gccctctgcatatgggagcttctctcaggagagcttccctttgctcacctcaagccggct
gcagctgctgctgagatggcctatcgcagtaccagaccacccatagccatcaccataccc
aagtccatcgtcaatatcctgcagatgatgtggagtccgaaccctgaggagaggccaacc
tttgcccagatcatccccatgctggatgactgtcgccaagagttcctggccgtaagcaaa
acactgtctggtgtgctgagcatgctggatgctgattgggctactccaatagatgacagc
gaggacggccttgagatgggatacagtggactagagccctcacccagtgacctggagcca
ggtgaacttcctgcaggcaacgtgacagctctaagaacgcagtgggaaatgtgtgccaag
tcgctgagtggggaaaagaatggaagcagtgtcttccctgcaacagataaaaatggttat
gtatctgatcctctgagcaccctacgagtgaacgattcacccatactacctcagcaggat
tga

DBGET integrated database retrieval system