KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576867Help
Entry
576867            CDS       T01019                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    576867
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    576867
   00020 Citrate cycle (TCA cycle)
    576867
   00620 Pyruvate metabolism
    576867
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     576867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 423 aa AA seqDB search
MEVGTVVRWEKQVGDQLNDGDLLCEIETDKATMGFESSEEGYLAKIFVEEGAKDVPVGRL
LCIIAEQESGVEAFKDFEDLGVIETPQGPPVPVKESPPAQVAAPPPPPPRPPPPPAAATP
STPPPPPPVPMAAPAAGVTQGRVFASPLARKLASERGININSLQGTGPGGRIVKADIESY
VPGVAGVPMPAAVPGAGFTDIPVDALRMEQANAAVYSKQTIPHYYLMADIDVGSVLRLQG
SLNEMVSEDTPITLNEFVIKAAALSCQKIPDANSAWFGDKIRQYHNVDVNIAVTSDYGTV
TPIINAANTKGLEAIRQEVDYVTALAQDGKMQTQGGTFSISNFGEFGVRGVAGIIPSPQA
CHLGIGAVQDRFVPDEDAEEGYRPASIVTVTLVCDHRVVDGAVGAQWLQQFKRYMETPHS
MLL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaagttggtactgtggtcagatgggagaaacaggttggagatcaactgaacgatggg
gatctgttgtgtgagattgagacagacaaagcgaccatgggttttgagtcttcagaagag
ggctacctggcaaagatctttgtggaggaaggtgccaaggatgttcctgttggaaggttg
ctatgtattatagcagagcaagaatcaggagtagaggctttcaaggattttgaagatcta
ggagtcattgaaacacctcagggtcctccagttcctgtcaaggagagtccaccagctcag
gttgctgctcctccaccacccccaccgcgcccaccaccaccaccagctgccgctacacct
agtacgccaccaccccctccacctgttcccatggcagcccctgcggcgggtgtgacccag
gggagggtctttgccagcccgttggcaaggaaactagcttcagagcgaggaatcaatatt
aatagccttcaaggtaccggtccaggaggtcgtatagtgaaggcagacatagagtcatat
gtccctggagtagcaggagtacccatgccagctgcagtacccggggcaggtttcacagat
atacctgtggatgcgctcagaatggaacaagctaatgctgcagtgtattctaaacagaca
atcccccattactatctcatggctgacatagatgtcggttcagtactcaggttacaaggc
agtctgaatgagatggtgagtgaggatacccctatcactctcaatgagtttgtcatcaag
gctgctgcattgtcctgccagaagattcctgacgccaactcggcgtggttcggagacaag
atcaggcaataccataatgtggatgtaaatattgcagtgacttcagactatggcacagtt
actcctatcattaatgcagcaaataccaagggtctagaagctatcaggcaagaggttgac
tatgtgacagctctagcacaagatggcaaaatgcaaacacagggaggaacatttagcatc
tcaaatttcggtgagtttggagttcggggcgtggctggtattatcccctccccacaagcc
tgccatctagggataggagctgtccaagatagatttgtacctgatgaagatgcagaggaa
ggatatcgtccagcatctattgttacagtaacccttgtatgtgatcaccgagtagtggac
ggcgcagtgggtgcacagtggcttcagcaattcaagagatacatggagacaccacactcc
atgctcctctag

DBGET integrated database retrieval system