KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576867Help
Entry
576867            CDS       T01019                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:spu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:spu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:spu00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 465 aa AA seqDB search
CLRSSTLFTPRLLYQLQKPCRFYSSEDLPAHYKITLPALSPTMEVGTVVRWEKQVGDQLN
DGDLLCEIETDKATMGFESSEEGYLAKIFVEEGAKDVPVGRLLCIIAEQESGVEAFKDFE
DLGVIETPQGPPVPVKESPPAQVAAPPPPPPRPPPPPAAATPSTPPPPPPVPMAAPAAGV
TQGRVFASPLARKLASERGININSLQGTGPGGRIVKADIESYVPGVAGVPMPAAVPGAGF
TDIPVDALRMEQANAAVYSKQTIPHYYLMADIDVGSVLRLQGSLNEMVSEDTPITLNEFV
IKAAALSCQKIPDANSAWFGDKIRQYHNVDVNIAVTSDYGTVTPIINAANTKGLEAIRQE
VDYVTALAQDGKMQTQGGTFSISNFGEFGVRGVAGIIPSPQACHLGIGAVQDRFVPDEDA
EEGYRPASIVTVTLVCDHRVVDGAVGAQWLQQFKRYMETPHSMLL
NT seq 1399 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaagctccaccctcttcacgcctaggctgctctaccagttacagaaaccatg
caggttttattcatcagaagatttaccagctcattacaagatcacccttcctgctctgtc
tccaaccatggaagttggtactgtggtcagatgggagaaacaggttggagatcaactgaa
cgatggggatctgttgtgtgagattgagacagacaaagcgaccatgggttttgagtcttc
agaagagggctacctggcaaagatctttgtggaggaaggtgccaaggatgttcctgttgg
aaggttgctatgtattatagcagagcaagaatcaggagtagaggctttcaaggattttga
agatctaggagtcattgaaacacctcagggtcctccagttcctgtcaaggagagtccacc
agctcaggttgctgctcctccaccacccccaccgcgcccaccaccaccaccagctgccgc
tacacctagtacgccaccaccccctccacctgttcccatggcagcccctgcggcgggtgt
gacccaggggagggtctttgccagcccgttggcaaggaaactagcttcagagcgaggaat
caatattaatagccttcaaggtaccggtccaggaggtcgtatagtgaaggcagacataga
gtcatatgtccctggagtagcaggagtacccatgccagctgcagtacccggggcaggttt
cacagatatacctgtggatgcgctcagaatggaacaagctaatgctgcagtgtattctaa
acagacaatcccccattactatctcatggctgacatagatgtcggttcagtactcaggtt
acaaggcagtctgaatgagatggtgagtgaggatacccctatcactctcaatgagtttgt
catcaaggctgctgcattgtcctgccagaagattcctgacgccaactcggcgtggttcgg
agacaagatcaggcaataccataatgtggatgtaaatattgcagtgacttcagactatgg
cacagttactcctatcattaatgcagcaaataccaagggtctagaagctatcaggcaaga
ggttgactatgtgacagctctagcacaagatggcaaaatgcaaacacagggaggaacatt
tagcatctcaaatttcggtgagtttggagttcggggcgtggctggtattatcccctcccc
acaagcctgccatctagggataggagctgtccaagatagatttgtacctgatgaagatgc
agaggaaggatatcgtccagcatctattgttacagtaacccttgtatgtgatcaccgagt
agtggacggcgcagtgggtgcacagtggcttcagcaattcaagagatacatggagacacc
acactccatgctcctctag

DBGET integrated database retrieval system