KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576951Help
Entry
576951            CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase 1-like
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    576951
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     576951
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   576951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 825 aa AA seqDB search
MAMSAEPQQSPPRKRARLSLKLVRKDQQTSRVIAPVTEEPGENKDEEPNQQCDTAGDVAS
SYMEPQSSSIPSEYVIRVAPYTGLHNLGNTCYLNSVLQVLRYCPSFSDNLNRLSGLVSEK
LKMKGEEEDIDEEDERSKRRRKEFIAQLKLVRAMNKLFSTMSEKEQSYVERLMPAGQELA
MYPEDILEAIRDLNSMFKGYLQHDAQELLCCILSNIQEACQRLGEHQGNTENTAYQDNVK
TEHSETCRKAVRKLDMGGAGDGVTMETECGKLLGGGRPLGGRTTRSDKTLNEKKLDCKSF
NSNGLVTHQENGFGDQPDSNGFGGHDRHVDSIKLCNGNITSTLRKSEKINGVAGGHHGGI
SPSNDSVRRRGGRKSALTNGHLSEKECNGMDGSLPETNGAGDCGSSKKKRLGLGRLTFQQ
YTLTKFGIIKKDKVPSTDEQHAQDDASHHHDIKSDTADDSKEVSLNGTYASRNVTSNNSN
DPDLSVDTTQVSLKVDDDVETVERLQGECSQPTTKEAIEKANIDKDKEISTELEDHTIPE
PSRAHCALTPMVQDVGDEGGAVDTADAVTFLSEMKVIERLFQGTLVLQTRCLECESCSEK
REDFQDVSVPVQSIPAFTSEEEHEERVPDVNPRNLSLGWALSEFTSVERLTDDNKYFCEH
CFHLTEAERSVLFGRLPGVLIIQLKRFSAFINCFSPGGSVSKVNDHLAIPLTLNLAKWCS
GSCQQKDTSYELSAVVAHSGSSSSSGHYIAYARVPQKNTESQACDADLPALDQCPGKESW
AKFDDDRVQVLSDEDFESLLNPLQGNDSAATPYLLLYKDTRQIRR
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagtgcggagccccaacagagtccaccaaggaagagagccaggttatcactc
aagcttgttaggaaagaccaacagacaagcagagtcatcgcacctgttacagaagaacca
ggagagaacaaagatgaggaaccaaatcagcagtgtgatacagcaggtgatgtagcatcg
tcttacatggagcctcaatcatctagcatccccagtgagtatgtgattagagtggctcca
tacactggtcttcataacctgggaaacacctgctatctcaacagtgtgctacaggtatta
agatactgtcctagcttcagtgataatctgaatagactctcaggactggtttctgagaag
ctcaagatgaaaggagaagaggaggatattgatgaagaggatgagaggagtaagaggagg
agaaaagagtttatagctcagctcaagttggttcgagcaatgaataagttgttcagcacc
atgtctgagaaggagcagtcttacgtagagcggttgatgccagctggtcaagaattagcc
atgtaccctgaagacatcttggaagctatcagggatttgaactcaatgttcaaaggctat
ctgcagcatgatgcccaggagcttctatgctgcatcctcagtaacatccaggaagcttgt
caacgactcggcgagcatcagggcaacacagagaatacagcttatcaggataatgtaaag
actgagcattctgaaacctgcaggaaagctgtgaggaaactcgacatgggcggggctggg
gatggtgtaactatggagacagagtgtgggaaactgttgggagggggtagaccccttggt
ggaaggacaacaagaagtgacaagacactcaatgaaaagaaattggattgtaaaagcttc
aatagcaatggactcgtgacgcaccaggaaaacggatttggcgatcaacctgattctaat
gggtttggaggtcatgatagacatgtggatagtattaaactatgtaacggtaacatcacc
agtactctgaggaagtctgagaaaataaacggggttgcgggaggacaccatggagggatt
tcaccaagtaatgactctgttcgaagacgaggtggaaggaagagtgctttgacaaatgga
catctttcagaaaaagagtgtaatgggatggatggaagtcttccagagacgaatggggca
ggagattgcgggagctctaagaagaagcgtcttgggctgggtcgcctgacattccagcag
tataccctgaccaagtttggcatcatcaagaaagacaaagttccatcaactgatgaacaa
catgcacaagatgatgcatctcaccaccatgatatcaaatcagatacggctgatgattca
aaggaagtgtcgttaaatggaacatacgcgtccaggaatgtaacgtctaataattccaat
gaccctgatctttccgtagatacaacgcaagtgtcattaaaagtggatgatgatgtagag
acagtcgaaagactgcaaggggaatgttcacaaccaaccactaaagaagctatcgagaaa
gctaacattgacaaagacaaggaaatatcaacagagctggaagaccacaccatacctgag
ccatcaagggctcactgtgctctaacaccaatggttcaagacgttggagatgaaggtgga
gcggtagacactgcagatgctgtaactttcttgagtgagatgaaagtcattgagagactc
ttccagggcaccctagtcctgcagacacgttgtctggagtgtgaatcgtgttcagagaag
agagaagatttccaagacgtcagtgttccagtccagagtattcctgcattcaccagtgaa
gaggaacatgaagaacgtgtaccagatgtgaaccctcgtaatctgtctctaggctgggca
ttgtctgagtttaccagcgttgagagactgacagatgataacaaatatttctgtgagcat
tgttttcatctgaccgaggctgagagatctgttctgtttggcaggctacctggtgtactg
atcatccagctcaagaggttcagtgcattcatcaattgtttctctcctggagggtccgtg
tcaaaggtcaacgaccatctagccatcccgctgaccctcaacctggccaagtggtgttca
ggctcctgtcaacagaaggacacatcctatgaactcagtgctgtggttgctcacagtggg
tcgtctagctctagtggtcattatatcgcctatgctagggtgcctcagaagaacacggaa
tctcaagcatgtgatgcagacctaccagctctagaccagtgtcctgggaaagagtcttgg
gctaaatttgatgatgatcgagtgcaggtcctgtctgatgaagactttgaatcacttctg
aatcctctacaagggaacgactctgcagctactccataccttctcctatataaagatact
cgtcagattagaaggtga

DBGET integrated database retrieval system