KEGG   Strongylocentrotus purpuratus (purple sea urchin): 576982Help
Entry
576982            CDS       T01019                                 

Gene name
SOS2
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    576982 (SOS2)
   04068 FoxO signaling pathway
    576982 (SOS2)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    576982 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1314 aa AA seqDB search
MMATVDYESEDYKKWRGLFVNALRKVQQQVHSNLQADEDSLEYIESLIICLLNMLCSVQP
HSVHEIEDRVQKTFPRPIDQWAINDARLALEKGRKKAPLVLPVEKIHQLLREVLGYRVDS
QVSLYLVAVLEYIAADILKLAGNYVKNICHSNISLQDIKVAMCADKVLMEMFCQDDDDAT
AMSSLSLEDEQDSRTGTLTYDEIVKDLIMEETQYVRDLNLIIKVFRKIFVDAPQHFNEEE
VESIFGNILDIYQLTVSFLGLLEDAMEMMDDSNSFLGIGECFEEMAEAEEFEVYSPYAAQ
ILSEDCRNTIQRLVAKPEVAEYLQEHNIRDAVSYVLPKLLLEPIYHCIHYFDSLKLLLKT
SPNEEEQEKFKQASSLLKILQAELDRICAGHLPKRKTGRESSLRFHRRLASRQVCIQRMN
EIQKNIEGWEGRDISEMCSEFIMEGNVGKVHTGKNKRANTERHIFLFDSMIVCCKLNTRR
SVSSSSPEYRFKERYYLRKIKVVDKHDGDDVKFAFEIEVKDSPQTIVFFAKSAEEKTSWM
EALITLLHRSTLERMLDTILQQEEDSQPLRLPSPEEYCFVEEDSPDNIVFEEGHKSMAGV
PLIKGGTLFKLIERLTYHRYADPSFVRTFLTTYRSFCSPQDLLSLLFKRFEIPDPPPTEE
DQASIDRGISVVREDLKRFRKEYAQPIQLRVLNVFRHWVDQHFYDFERDSELLGSLEKFI
DESVRGKGMRKWVESIKKIIMRRVNWDVEEQRHILTFEKDPPPIEHHISKSPLDFDIMTL
HPIEIARQLTLLESDLYRAVTPSELVGSVWTKKDKHLTSPNLLKMIHHSNMFILWLEKCI
VETTNLEERISVVSRVIEIMMVFQEYNNFNGVLEIVSAFNSSAIHRLEHTFRDLRKKQVL
EEAKELGTDHYKKYQEKLRSINPPCVPFLGMYLSNILFIEQGNPDFLSNCPEGLINFSKR
RRVAEITGEIQQYQHQPYCLNPEPEIRKFFEDLNPLGDMTEKEFQDYLYETSLEIEPRNC
KQLPKFPKKFEYSLKSPGIKPSSNRHMSLVGTSRLTNELRSPGFTRMQDDEATSPKAGAT
PPSPRTPTILSTPSSIFSQNSVFSVVDIPNNSNSSSTAAEEPPEVPPPLPPRSRLSSTPN
PCSSQDRLHDIPPLPPRFNHAPPLPPRHNSQNSSQTMNGGTPTIPPRTYRSPHSHSLQRK
ASNPLPNKSSTTTTSSRPPPLPPPITHLPDSDIWLPRTPQAQKSHAFLLSQNSPASSFPM
NNTDHIGFKPLMPPPRPRGPRLAERLAEPDRPPRTPSKENQLTPEDLKFFESSY
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
atgatggccactgtagactatgaatctgaagactacaagaaatggaggggcttgtttgtt
aatgcccttcggaaggtgcagcagcaggttcattccaacctgcaggcggacgaggactcc
ttggaatacattgaaagtctcatcatctgcctcctcaacatgctgtgcagcgtccagccc
cacagcgtccacgagatcgaggacagggttcagaagaccttccctcgccccatcgaccag
tgggccatcaacgacgcccgtctggccctggagaaggggcgcaagaaggctcccctggtc
cttccggttgagaagatacaccagctcttgagggaggtgcttggctatcgtgtagattca
caagtttctttatacctggtggcggtactggagtacatagcagcagatattctaaagttg
gcaggcaactatgtgaagaacatctgtcatagcaatattagcctgcaggacatcaaagtt
gctatgtgtgctgacaaggtgttgatggagatgttctgccaggatgatgatgatgcaaca
gcgatgtcatccctgagtcttgaagacgagcaggacagtagaacggggacgttgacctat
gatgagatagtcaaggatctcatcatggaggagacacagtacgtacgggatctcaacctc
atcatcaaagtcttcaggaagatctttgtcgatgcaccacaacactttaatgaggaggaa
gtggaatccatctttggcaacatcctagacatctaccagctgacggtctccttcttgggt
ctcctggaggatgccatggagatgatggatgatagtaactctttccttggtatcggagag
tgcttcgaggagatggcagaggcagaagaatttgaggtgtacagtccttatgctgcacag
atcctgagtgaagactgtaggaatacaatacaaagacttgtagctaagccagaagtagcc
gagtacctacaggagcacaatattcgtgatgcagtatcctacgttctacccaagcttcta
ctagaaccaatctaccactgtatacactactttgactcgctgaagttattattaaagacc
tcacctaatgaggaggaacaagaaaaattcaaacaagcatccagtcttctgaagattttg
caggcagagttagacagaatatgcgccggtcacttgcctaagaggaagacagggagagag
tcttccctgaggttccaccggagactagcatcaagacaggtctgcatccagcgcatgaat
gagatccagaagaacattgaaggatgggagggacgagacatcagtgagatgtgtagtgag
ttcatcatggaaggcaacgttggcaaggtccatacaggcaagaacaaaagggccaacaca
gagagacacatcttcctgtttgacagtatgatagtgtgctgtaagctgaacacgagacgg
tcggtctcaagctcgtcaccggagtaccgcttcaaggagaggtactacctcaggaagatc
aaagtcgttgacaagcacgatggagatgatgtgaagtttgcctttgagatagaggtcaaa
gactcaccacaaaccatagttttctttgccaagagtgcggaggagaaaacaagttggatg
gaggcccttataaccctcctacacagaagcaccctagagagaatgttggacactatctta
caacaggaagaagatagtcaacccctaaggcttccatctccagaggagtactgctttgta
gaagaagactcaccagacaacatcgtctttgaagaaggtcacaagtcaatggcgggagtt
cccctcatcaagggaggaaccctcttcaagctgattgaaagactgacctatcacaggtac
gctgatccgtccttcgtccgaaccttcctcaccacctacaggtcattctgcagtccacag
gatctactctcgttactcttcaagaggtttgagatcccagaccctcctcctacagaggaa
gatcaagcatccattgatagagggataagtgtggtcagagaagacctcaagagattcagg
aaagagtatgcacaacctatacaactcagagtactgaatgtattcagacactgggttgac
caacacttctatgactttgagcgagattcggagttacttggaagcctagagaagttcatt
gatgaatcggtgcgagggaaaggcatgaggaaatgggtcgaatctatcaagaaaatcatc
atgaggagagtaaattgggatgtggaagaacagaggcacatacttacatttgagaaagat
cctccgcccatagagcatcatatatccaagtcacctctagactttgatatcatgaccctt
cacccgattgagatcgctaggcagctgaccttactggagtctgacctctaccgagcggtc
actccatccgagctggtaggcagtgtgtggactaagaaagacaaacacctcacatcacct
aacttactcaagatgatccatcattcgaatatgttcatcttatggttagagaagtgcatt
gttgagacgaccaatcttgaggagaggatctctgtggtatccagagtcatagagatcatg
atggtgttccaagagtacaacaacttcaatggcgttctggaaatcgtcagtgcattcaac
tcatctgccatccatagactggagcatacctttcgggatttgaggaagaagcaggtatta
gaggaggccaaggaactaggcacagatcactacaagaaataccaagagaagctacgctcc
atcaatccaccttgtgtgcctttcttgggaatgtacctaagcaacatcctgtttatagag
cagggtaacccagacttcctctccaactgtccagagggcttgatcaacttcagtaagagg
cggagagtagctgagatcactggagaaatccagcagtaccagcatcaaccttactgtctc
aaccctgaacctgagatcaggaaattctttgaggacttaaatcctcttggtgacatgaca
gagaaggaattccaggactatctctacgagacatcactggaaattgaacccagaaactgc
aagcagctgccaaaatttcccaaaaaatttgagtactctttgaagtcccctggcatcaaa
ccctccagcaatagacacatgtcattggttggaacatcaagactcaccaatgagctcagg
tcaccagggttcacgaggatgcaggatgatgaggccacctcccccaaagcaggtgccaca
cccccttctccaagaacaccaaccattctatcaacaccatcgtcgatctttagccaaaat
agtgtcttcagtgtcgtggatattccaaacaactccaactcgtcatccacagcagcagag
gaaccaccagaggtacctcctcctctaccaccccgaagccgtctgagctccacccctaat
ccctgcagcagtcaggatcgcctccacgacataccaccgctccctccaagattcaaccac
gcccctccattaccacccagacacaactctcagaactcatcacagacaatgaatggcggt
acacccacgatacccccaaggacttaccgtagcccccactcccactcgcttcaacgcaaa
gcctccaatccgctgccgaacaagtcttccaccaccacgacgtcgtcgaggccgcccccg
ctcccaccacccataacgcacttacccgattcagatatctggttgccaaggactcctcaa
gcacagaaaagtcatgccttcttactatcacaaaactctccagcatcctcttttccaatg
aacaacactgaccacattggtttcaagcccttgatgcccccgccaagaccacgtggtcca
cgactggctgaacggctggctgaaccagacagaccacctaggactccttcaaaggaaaat
cagttaacgccagaagatctgaaattctttgaaagctcttattaa

DBGET integrated database retrieval system