KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577020Help
Entry
577020            CDS       T01019                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    577020
Enzymes [BR:spu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     577020
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   577020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 336 aa AA seqDB search
MSSPVIPPPKHVLHSTFHHEVLRSWQNIDTTITPDNLVYPLFIIDNPDLIEPVSSLPGVN
RYGVNTLQAALTPLVAKGLKAVLLFGVPTGLPKDTRGSSADTEDSPVIQAIHVISEKFPQ
LLISCDVCLCAYTSHGHCGILNEGGTLDNEASIQRLAEVALSYAQAGCHVVAPSDMMDGR
VGAIKHLLMTNGLGNKVSVMSYSAKFASCFYGPFRDAAKSAPSFGDRRCYQLPPGARGLA
MRAVDRDVAEGADYLMVKPGMPYLDIVRDTKEKHPDLKLAVYHVSGEYAMLYHGANQGAF
DLSKAVMEAVKCMRRAGADIIITYFVPDILEWIKNT
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagttccccagtgatccctcccccaaagcatgttcttcatagcaccttccatcatgaa
gtgttacgatcgtggcagaacattgacacaaccatcacacccgacaatcttgtataccct
ctctttatcatagataacccagacctgatagaaccagtttctagtctcccaggagtaaat
agatatggagttaacaccttacaggcagcactcactccactcgtagccaaaggccttaaa
gctgtcttactctttggagtgccaacaggtctacccaaggatacaagagggtcaagtgca
gacactgaagactcgcccgtcattcaagctattcatgtgatctcagagaagttcccccag
ctccttatctcttgtgatgtgtgtctctgtgcctatactagtcatggtcactgtggtatt
ctcaatgaaggcggcaccttggacaacgaggcaagcattcagaggttggctgaggtcgca
ctctcatacgcccaggctggttgtcatgttgttgcgccctctgacatgatggatggaaga
gtaggcgccatcaagcaccttctcatgaccaatgggttgggtaacaaagtatcagtgatg
agctacagtgctaagtttgcttcttgtttctatggtccgttccgtgatgctgccaagtca
gcgcctagctttggagaccgaaggtgttaccagctacccccaggggccagggggcttgcc
atgagagctgtggatcgtgatgtagcagagggagctgattatctaatggtcaagccaggc
atgccataccttgacatagtaagggataccaaggagaagcatcctgatctaaagctagca
gtgtaccatgtatcaggggagtatgctatgttgtaccacggggctaaccagggagccttt
gacctgtccaaagccgtcatggaggcggtcaagtgcatgaggagagcaggagcggacatc
atcatcacatacttcgtgccagacattctggagtggatcaagaatacataa

DBGET integrated database retrieval system