KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577219Help
Entry
577219            CDS       T01019                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 577219
NCBI-ProteinID: XP_779928
UniProt: W4Y4L0
Position
Un
AA seq 118 aa AA seqDB search
MSADENTKWTLPSGDPEKGKVIYANICASCHCVEPGGTSRSGPNLSGVWGRQAGTLPGYK
FAKSDEKKGIIWNDRRLWDYFEHGHIPGTRMFFRALKKDQQKRADLLAYLKIASAPPK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgatgaaaatactaaatggaccctccctagcggagacccagagaaaggaaag
gtaatatatgcaaatatatgcgcttcgtgtcattgcgttgaacccggtgggaccagcaga
tcgggaccaaacttatcgggggtctgggggcgccaggcgggcaccctacccggctacaag
ttcgctaaatccgatgaaaagaaaggtataatttggaatgacaggaggctatgggattac
tttgagcatggtcatatacccggtaccaggatgttctttagagctctaaaaaaggaccaa
cagaaacgagccgatcttctagcgtacctcaagattgcgtcagccccgccaaaatga

DBGET integrated database retrieval system