KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577224Help
Entry
577224            CDS       T01019                                 

Definition
uncharacterized LOC577224
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    577224
   04330 Notch signaling pathway
    577224
   04350 TGF-beta signaling pathway
    577224
   04630 Jak-STAT signaling pathway
    577224
   04068 FoxO signaling pathway
    577224
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     577224
Transcription factors [BR:spu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    577224
Mitochondrial biogenesis [BR:spu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    577224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2680 aa AA seqDB search
MADQIVDGPPSKRQKLASPANASNERGESELTKLLDIDVPPLSDDLHVISHSTNETPVSF
SSASVSLSSIGGASGGSASVTVASSMPVATDTHNDPLKKNTQLTKLLQSPPRTGVSAQVS
QPGSVMGKAVAVSSGMQQNQLQGGVTNSSLANISRSFTNSPVPNSIAKQAGGQGLAPSPT
MNQTVGVTSGIANARTNNTSGANTMGQFNPSTGAMPINSMGNANVASNMGPGHGMIGNRP
NMMNGPFQGGDGMAMGMTNSMVRNNNPVANSIALQQMANNNAMGNSAVVNVGQPNMISGM
DPAMAKARAAKVGGMANVQHMTQSNTNNPFHGFSSSMNTMPTPTSNMNALSSFVPTTTST
YALGNMVDGLNMPGNMNINPNNMGSPAANMNPNIAGGAPNMVRNVITNLPGNMGGNTNMM
HPNMIAGGNFRGSMNVQGTLQRAISSGNVNIAANNAGASIQDANRSDNIAGNHGVGAVSN
VNMNAQAGVNVQQQQQQQQPISAQQSLAGVGVGTAGAGGSQASAADPGKRKLIQRQLVLL
LHAHKCQRRETAANGEVKPCALPHCRTMKNVLNHITNCQAGKSCQVAHCASSRQIISHWK
NCTRNDCPVCLPLKNASDRKQQNSTASQFLQNLAPVSVDHNSMARAFESLGIPIKTPRMS
GESGGNLLNQQTIPQASGTPGNLPRPVLNQPLTSAGLEQQQQQQQQQQQQQQQQQQQQLP
TQQQQQQQQGQQQVPPQVAQQVVQQQQQGQAQQPQPTTQPGQAQQQRPPQQQSSQQTALS
TNSNVPPASSFQGMNSLSNTLTNAGPANTMCVPSSIAAAAVSTLAAMDSNATFSSSLNTS
NIIKSIRSQEINVSSASGLPAAIQSQANQPWHAFVTQDLRAHLVHKLVQAIFPSPDQAAL
RDKRMGNLVAYARKVEKDMYEQAGSREEYYHLLAEKIYKIQKELEEKRQKRVAEQHGNRL
PGTVGPGGQLIPGQLPGQGASRGGLTGLSQSEYISTVLQDLSGVTPNGPKRDLTMNSTVP
EQFVNMANSIVQVPTTVNTQQKPGQQSTMQVPLHPGQQPQQPPQQQQQQLANQQQQQQQQ
PQPNQNPFRNFPPIPVTSQSMANAVGKVPASVGMAKPQSVGAISSQAQQPTQQQQIATQN
NTSPLASSLPSVSSVSSSQPTPQASLSGPLSNHTDHGEDVKPQMGGKQLPSNNPASVAEK
IIKQEPPETPGLKSKPSMGKGYIKQESSSTSAPGKPCSYGDKPSNASIKSEPFIKSEPME
HDGNGKHEVSATKMTFSKTPKASNSTTTSNGSSLNSTRATTSGNKDGAMSTQMVKNESKK
PKAMKTFKPDELRQALMPTLEKLYRQNPESLPFQQPVDPHKLQIPDYFDIVKTPMDLQTI
KNKLDTGQYIDPWQFVDDVWLMFDNAWLYNRKTSRVYKYCTKLAEVFEQEIDPVMQELGY
CCGRKHVFHPQVLCCYGKQLCTIPRDAHYWTYQNRYHFCEKCFNDIQGETVVLGEDPTQS
QTPYFPSQQSRTIEKKTFCRKKNDILEPEPMYNCLECGRKLHQICVLHVDVIWTDGFICD
GCRKQKNIKKKENKFTAKKLQPSKLGTHLENRVNKFLRDRNAGAGEVVIRVMSCTEKIVE
IKSGMKSRYLYGDDLPDTFPYRSKALFAFEEIDGVEVCFFGMHVQEYGSDSPKPNQGRVY
ISYLDSVHFFQPRAFRTAVYHEILIGYLEYTGCLGYEFAHIWACPPSEGDDYIFHCHPVE
QKIPKPKRLQDWYRRMLDKALGDGVINIYNDIMNAALEDGLTCATELPYFEGDFWPNVLE
ESIKELDQEEEERLKAAEKAAAAQSATEEQPQGGPNGSKKTQKKCKKTNKSKSSSTRKNN
KKTNFPQQGNDLTQKLYATMEKHREVFFVIKLKRAHNEKIHDPDPLITCDLMDGRDAFLT
MARERHYEFSSLRRAKFSSLCMLCELHNQGQDRFVYTCNECKHHVETRYHCTVCEDYDLC
AVCYEKIKHEHKMEKWGLELDVEPGSNAVRNPQEARHLSIQRCIQSLVHANQCRDANCCL
PSCQKMKRVIQHTRGCKKKTNGECPICKQLITLCCLHAKHCQEQKCTVPFCINIKHKLRQ
QQLQQRLQQAQLLRRRISAMTRGAPAPSQPAVQVQAKQTAAIQQQQQQAALPPGQQQAAI
AAPPQQPNIPAVPPPPQGALDAVKIVQQQVDATRNPINQIAQPIRTISPTPTAAQRGNPN
MKTVISQPMMQQQQQQQQQPQQQHGGKLQKSVSMPPGGVASMNQLGQWRGPMDQTGHIQG
QVPVMQQHAQGMVIHNTAQPQQNHMTQVPQPGQQQIPPQRNNAPQQALQQLLQTLKSPHS
PQQQKQVLTILKSNPQLMAAFIKQRSEHQQRMQQQQQQHGQLQQGNMQAAGQPVPQQQMA
QPNMQQQPAQQIMNQTWMQPQQQRQRPRFQQGYIQQQIQPQNPGKPFQQMATGHPAQYSQ
HPSAMQQRRNMMPQAMQQLQQQQQQQQQQQQQQQQQQQQQQQGMTQGDPAMQYMLQGQVQ
QQGIMSNRSPQQVLSQVRSPQTTNNPLAQVRSPQTNANNPLAQVRSPQTNSNALVQVRSP
NPNQSPRPQSQPAPSPRTHSAQPSPRSVGAINSPHPVGGTDIQMDQTPVLSQNPTPMGHS
NKNSLQSPATVGGAAPGLQEENDMTPLDPQDQLSKFVEML
NT seq 8043 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccaaattgtcgacgggccgccatcgaaaaggcaaaaattagcgtcaccagcg
aacgcttccaacgaacgtggtgaatcagaattgaccaagcttcttgatattgatgttcca
cctctgtccgatgaccttcatgtgataagccacagtaccaatgagactccagtgtcattc
tcatcagccagtgtcagtctgtccagtatcggaggagcgagcggtggcagtgcttcagtt
accgttgcatcatcaatgccagttgcaactgacacacataatgacccccttaaaaagaac
acacagctaaccaagttgctgcagtctcctccccgcacgggagtgagtgcacaagtcagt
cagcctgggagcgtgatgggaaaagctgttgcagtgtcatcgggaatgcagcagaatcaa
ctgcagggtggagtcaccaactcaagccttgccaacatctcccgttcttttaccaatagc
cctgtgccaaatagcattgcaaagcaggctggagggcaaggtttagccccttccccaact
atgaaccagactgttggtgtaacttcgggaatcgccaatgcacggacaaataacactagt
ggagctaacactatgggtcaattcaatcccagtactggggcaatgcccataaacagtatg
ggtaatgcaaatgttgcctcaaacatgggacctggtcatgggatgataggcaataggccg
aatatgatgaacggaccttttcaaggtggagatggaatggccatgggcatgaccaattcc
atggttaggaataacaatcctgtggccaattcgatagcactgcagcaaatggccaacaac
aatgcaatgggcaatagtgctgtggtcaatgtaggacaacccaatatgataagcggaatg
gatccagcgatggcgaaagcaagggctgcaaaggtgggtggtatggcaaatgtacagcac
atgacccagtcaaacaccaacaaccctttccatggattctcctcttccatgaacactatg
cctacacccacatccaacatgaatgcattatcctccttcgtgcccaccacgaccagcact
tatgcattagggaacatggtggatggactcaatatgcctggcaatatgaacatcaatccc
aacaacatgggctcacctgccgcaaatatgaaccctaatatcgctggaggtgctccaaac
atggtcaggaatgtgatcactaacttgcctggaaatatgggtgggaacacgaacatgatg
cacccgaacatgattgctggtggcaattttaggggaagtatgaatgtgcaaggaacgtta
cagcgggccatatcatcaggaaatgtgaacattgcagcaaacaatgctggggctagtatt
caagatgcaaatagaagtgacaatattgctgggaatcatggtgttggtgctgtaagcaat
gttaacatgaatgctcaagctggagtgaatgtgcagcaacagcagcagcagcagcaacca
atcagtgctcaacagtcacttgcaggagttggcgtaggtacagcaggagcgggtgggtcc
caggcttcggcagcagatccgggcaagcgtaaactcattcaaaggcaactggtactactc
ttacatgcgcacaagtgccaaagacgagaaactgcagcaaatggagaggtgaagccctgc
gctctcccacactgccgaaccatgaagaatgttctcaatcacattaccaactgccaagct
gggaagtcttgccaagtggcccactgtgcttcatcaaggcagattatttcccattggaaa
aactgcacaaggaacgactgtcctgtgtgtctcccactgaagaatgcttcagatcgtaaa
cagcaaaattctacagcaagtcaatttctgcagaatcttgcaccggtctctgttgatcac
aactctatggcacgtgcatttgaaagtcttggtatccccatcaaaactccaagaatgtca
ggggaatctggaggtaatctgcttaaccagcagactattccgcaagcatcaggcacgcca
ggaaatcttccacgtcctgtcttgaatcagcctcttactagtgcaggattagaacaacag
caacaacaacaacaacaacagcagcaacaacaacagcagcaacagcaacagcagttgcca
acacagcagcagcagcagcagcaacaaggacagcagcaggtacccccacaggtagcacag
caggttgtacagcagcagcagcaagggcaagctcagcagcctcaaccaaccacacagcct
ggtcaggcacagcagcagcggccaccgcagcagcagtcatcacaacagactgcactctct
acaaacagcaatgtgccgccagccagcagtttccaaggcatgaactcgctgagcaacacc
ctgaccaatgcaggacctgccaacacaatgtgtgtgccaagcagcattgctgcagcagct
gtatcaaccttagcagccatggattccaatgcaaccttctcttcaagtttgaacacctcc
aacatcatcaagagcatcaggagtcaggagatcaacgtgtcttctgcgtctgggctccca
gctgcaatacaatcccaagccaaccagccatggcatgcattcgtcactcaggatctcagg
gcccaccttgtccataaattggtgcaagcaatatttccctcccctgatcaagcagccttg
cgggacaagcgcatgggaaacctggttgcttatgcccgcaaagtggagaaagacatgtac
gaacaagcaggcagtcgggaggagtattaccatctcctggctgagaagatctacaagatc
cagaaggaactggaggagaagcggcagaagagggtagctgagcagcacggcaatcgctta
cctggcaccgtgggtccaggaggccagttgataccgggtcagcttccgggtcagggagcc
agccggggtggcctcactggtctttcacagagtgagtacatctctactgtgctgcaagat
ttgagtggagtgactccaaatggccccaaacgtgatcttacaatgaattccactgtacct
gagcagtttgtaaatatggcgaatagtattgtacaagtgccaactactgtcaacactcag
caaaaacctggccaacaatcaacgatgcaggtaccactgcaccctggccagcagccacag
caaccaccacaacaacagcagcagcaacttgccaaccaacaacaacagcagcagcagcag
ccacaacccaaccagaatccgttccggaacttccctcccatcccggttacatcgcagtcc
atggcaaacgctgtaggcaaggtccctgccagtgtgggcatggcaaagccgcagagtgtt
ggtgccatatcgtctcaggcacagcaacccacccagcagcaacaaattgcaactcagaac
aacacgtcacctcttgcttcttcattgccatcagttagttctgtgtcttcaagtcagcca
actccgcaggcaagcctatctggtccactctcaaaccatactgatcatggtgaagatgtg
aagcctcagatgggaggaaaacaacttcccagcaataacccagcatcggtggcagagaag
atcatcaagcaagagcccccggagacacccggattaaagagtaaaccgtccatgggtaag
ggttatatcaagcaagaatcatcatccacatcagcccctgggaaaccctgtagctacggt
gacaaacccagcaatgctagtatcaagtctgagccattcatcaagtcagagccgatggaa
cacgatggcaacggcaagcacgaggtctctgcaaccaagatgaccttctccaaaacaccc
aaagcaagcaacagtacaaccacaagtaatggttcatcacttaacagtacaagggccacc
acgtccggcaacaaggatggtgctatgtcaacgcaaatggttaagaatgaatccaagaaa
ccaaaggcaatgaagacatttaaacctgatgaattgaggcaggccctcatgccaactctt
gagaagttatatcgccaaaacccagaatcgttacccttccaacagccagtagatcctcac
aagctgcagattccggattacttcgacatcgtgaagacgccaatggacctgcagaccatc
aagaacaagctggacacaggccagtacattgacccgtggcagtttgtagatgatgtgtgg
ctcatgtttgacaatgcgtggctctacaaccgcaagacttcaagggtctacaagtactgt
accaaactggccgaagtctttgagcaggagattgatccagtcatgcaggagctgggctac
tgctgtggtagaaagcatgtgttccatcctcaagtgttatgttgttatggaaaacagcta
tgtactattccaagagatgcccattactggacataccagaacaggtatcatttctgtgag
aagtgcttcaatgacatccagggtgagacagtcgttctgggagaggaccctacccagtca
caaacgccttattttccttctcaacaatccaggacgatagaaaagaagacattttgcagg
aagaagaatgatattcttgaacctgaaccgatgtacaactgccttgagtgtggtcgtaag
ttacatcaaatctgcgttcttcatgtggatgtgatctggaccgatggcttcatctgtgat
ggatgtcggaaacagaagaatatcaagaagaaagagaacaagttcacggcgaagaaactg
caaccttccaagctaggaactcaccttgagaacagggtcaacaagtttctcagagaccgc
aacgccggtgctggtgaagtggtcatcagggtcatgtcctgtacagagaagatcgtcgag
atcaagtcaggcatgaagtcgagatatttatacggagatgatcttcctgatacctttcca
tacaggtcgaaagcactctttgcctttgaggagattgatggggtagaggtgtgcttcttt
gggatgcatgtgcaagaatacggctcagatagccccaagccaaaccaggggcgagtgtat
atatcctacctggacagtgtccatttcttccaacctagggctttcaggaccgctgtctat
catgaaatacttattggttaccttgaatacaccggatgtcttgggtacgagtttgcccac
atctgggcttgtccaccgagtgaaggggacgactacatcttccactgtcatcctgtcgag
cagaagatccccaagccaaagagactgcaggactggtacaggaggatgctggacaaggcc
ctgggggatggtgtcattaatatctacaatgacatcatgaatgcagctctcgaggatggg
ttgacctgtgccactgagcttccctactttgagggtgacttctggcccaacgtcctagag
gagagcatcaaggagctggaccaggaggaagaggaaaggctcaaggctgctgagaaggct
gctgctgcccagagtgcaactgaagagcaaccacagggtggtccaaatggtagcaagaag
acgcagaaaaagtgcaaaaagacgaacaagagcaaaagcagcagtacccgcaagaacaac
aagaagaccaactttccacagcagggcaacgatcttactcaaaagttgtatgccaccatg
gagaaacacagagaggtcttctttgtcatcaagctcaagcgagcacacaacgagaagatc
cacgatcctgacccactgatcacctgtgacctgatggacggacgtgatgccttcctcacc
atggccagggagaggcattatgagttctcctccctgcgtagggccaagttctcttctctc
tgcatgctgtgtgagcttcacaaccagggtcaggataggtttgtctatacctgtaacgag
tgcaagcatcatgtggagaccagatatcattgtactgtgtgtgaggattacgacttatgt
gctgtttgctatgagaagatcaagcacgagcacaaaatggagaaatggggactagaactg
gatgtggagcctggctccaatgcagtgaggaacccacaagaggctcgtcatctctccatc
cagcgttgcattcagtcactggtccatgccaaccagtgcagagatgccaactgctgcttg
cccagctgccagaagatgaagagggtcatccagcatacgagaggctgcaagaaaaagacc
aatggagaatgtcccatctgcaagcagctcatcactctgtgttgtttgcatgccaagcac
tgtcaggaacagaagtgtactgtgccgttctgcatcaacatcaagcacaagctacgacag
cagcagcttcagcaaaggctacagcaggcccagctcctgcggcgtaggatatcggctatg
acacggggagcaccggctccgtctcagcctgccgtgcaagtgcaagcaaaacaaacagcg
gcgatacaacaacagcaacaacaagcggccttaccacctgggcagcagcaggcggcaata
gctgctcctccacaacaacccaacattcctgcagtgccaccacctcctcaaggtgctctt
gatgctgtgaaaatagtgcaacaacaagtggatgccactaggaatccaatcaatcaaatt
gcacaaccaatcaggactatttcaccaacgccaaccgctgcgcagcgaggcaaccctaat
atgaaaactgtcattagtcagccaatgatgcaacaacaacaacaacaacaacagcagccg
cagcaacagcatggtggaaagttacagaaatctgtttcaatgcctcctggtggtgtagca
tcaatgaaccaacttggtcagtggagagggcctatggatcagacaggacacattcagggc
caagtgcctgtcatgcagcaacatgcacaaggcatggtcattcacaatacagctcaaccg
cagcaaaaccacatgactcaggtacctcaaccaggtcagcagcagatacctccgcagcgg
aacaacgcgccacaacaggcgctgcagcagttgttgcagacgctgaagtcgccacactcg
cctcagcaacagaagcaggtgctgaccattctgaagtccaacccccaactgatggctgcc
ttcatcaagcaaaggtcggagcatcagcagcggatgcaacagcagcagcagcaacacggg
cagctgcagcaaggcaacatgcaggctgctggtcagcctgtaccacagcagcagatggct
cagccaaacatgcagcagcaacctgcacagcagataatgaatcaaacatggatgcagcca
cagcagcaacgacaaagaccaaggtttcagcagggttacattcaacagcagatacagcct
cagaaccctggcaagcccttccaacaaatggccactggccacccagcacagtacagtcaa
cacccttcagccatgcagcaacgtcgtaacatgatgccgcaggccatgcagcaactccag
cagcagcaacaacagcagcagcagcaacaacaacaacagcagcaacagcagcagcagcaa
caacaaggcatgacacagggtgaccctgccatgcagtacatgcttcaaggacaggttcaa
cagcaaggtatcatgtccaaccgctcgccgcagcaggttctgtcgcaggtccgatcaccc
cagaccaccaacaacccccttgcccaggtccggtccccacagaccaatgccaataatccc
ttagcccaggtcaggtctccacagaccaattccaacgccctggtacaggtccggtcgccc
aatcccaaccaatcgccaagacctcagtcgcaacccgccccctcaccaagaactcattca
gctcagccttctccaaggtcggtaggagcaataaactcccctcaccctgtgggtggaacg
gacattcaaatggatcagacccctgtgttgtcacaaaacccaacgcccatgggccatagc
aataagaactcgctgcagagtcccgctacggtgggtggagcagcaccaggtctacaggag
gaaaacgatatgacaccgcttgatcctcaggaccaactctcaaagtttgtagagatgttg
tga

DBGET integrated database retrieval system