KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577424Help
Entry
577424            CDS       T01019                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    577424
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     577424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 456 aa AA seqDB search
MAALNPFGALDAPSVTHADRRGGRVLTYRGYRYTRSNSSHTRIYWRCARVNCGETIITNR
FNINHTNPEIHIQQRPLGDHTHEPDDERIRRRQFIDEATALLRTNPTLVIRRAYDIVRDT
GNHYPPDIPTFKEIRSQLQRVRSEIVNADRIIMPRKKLKTVGPSGDNPATSVTTPPPPPP
PPPPAASGLPTTPPPTTLPSSATTQSNGDESVAEKFISLMEDMVRELDKLKFGDPVSYIY
NPLEYAKETHDCFIRKYGNSTKSVLFLGMNPGPFGMAQNGVPFGETNYVKDWMKITGNVG
RPPKEHPKRIIIGLDCNRSEVSGQRFWKLWKDLCGTPENFFKECFVYNHCPLVFMTSTSK
NVTPPSMKIEMRNPLNDVCDDYLCRMIQLLGVKVVVGIGKFAEARTKKALEKGGVEGVRV
VTIMHPSPINPAANKGWQNIVEKTLEDLDLMKYISK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcagccttgaatcccttcggggcacttgatgccccgtctgtcacacatgcagacagg
cgaggtgggagagttttgacctacagaggctatagatacacccgtagcaacagttcacac
actcggatctattggcgatgtgcaagagtcaactgtggtgaaacaatcataacaaaccgc
ttcaacattaatcatacaaatccagagattcatattcaacagcggccgcttggggatcac
acgcatgaacctgatgatgagcgaatccgtcgaagacaatttattgacgaagcaactgca
ttgctcagaactaatccaactcttgtaataaggagggcatacgacattgttcgagataca
ggaaaccactatccgccagatatacccacatttaaggaaatcagaagccagctgcaacga
gtccgttcggaaattgttaacgctgatagaatcataatgcctcgcaagaagctcaagaca
gttggaccatcaggagataatcctgcaacgtctgtgacaacaccaccaccaccaccacca
ccaccaccaccagcagcatcaggcttgccaacaactccaccaccaacaactctcccaagc
tctgcaacaactcaatcaaatggagacgaaagcgttgcagaaaagttcatctcgctaatg
gaggacatggtgagagaactggacaagctcaagtttggcgaccctgtgagttacatctac
aatcctctggaatatgccaaggagactcatgactgtttcatcagaaagtatggcaactca
accaagtctgtgctcttccttggaatgaatcctggcccattcgggatggcacagaatggg
gtaccgtttggagaaaccaactatgtgaaagactggatgaagattacaggaaacgttggc
agaccaccaaaggaacatcccaagcgcatcatcattggacttgactgtaaccgcagtgag
gtcagtggacagcgtttttggaaattatggaaggatctgtgtggcactccagagaacttc
ttcaaggaatgttttgtgtacaaccactgccctctagtgttcatgacatcaacgagcaag
aatgtcactcctccgtccatgaagatcgagatgcgcaatcctctgaatgatgtctgtgat
gactatctatgtaggatgatccagctgttgggggtgaaggtggtggtagggattgggaag
tttgccgaggctaggaccaagaaggccctcgagaagggaggggtggaaggggtgcgggtg
gttaccatcatgcacccaagtcctattaatcctgctgctaacaagggatggcaaaatatt
gttgaaaagaccttagaagatcttgatcttatgaagtatatcagtaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system