KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577552Help
Entry
577552            CDS       T01019                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 47
  KO
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     577552
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   577552
Ubiquitin system [BR:spu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    577552
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 408 aa AA seqDB search
MSPLPGPLNPQIMDAIHRRRDAVDQACDRGGDGVEQGGPSEPPLGYVEPSVDSDQEVSDA
ARALKKKKIWYFKPLELSDTEEGRVLLVNLDRRMSLGFFKSCVETHVGTTSLNFKVYRVY
ANNQEFESIRLNETLQSYSDDSRIVIKLGRALRKGEYRVNIHQLLVNSNEPIRYLFDWVF
AKGMTVLQSKKELLPELKKKCSIDIPLDRLRLRKKSWKNPATIFLNDRIYEEDIPIFTNW
EVFVELLDRPEQVASSSQLALYVRRWRPSQMKLDPFEEVILDDTNVSDLKTALSELSEIP
LENIEFAKGRGTFPCEISLLEMNTDLEWEPRVTALNTWPLYITDDGTVIYYRDNREELKE
LQEDEKKEIQKKENARLSKTGQKVTYSPRKERALKIYTDSPPPYSAIN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagccctctccccggacccctcaaccctcagatcatggatgctattcataggcggagg
gatgcggtggaccaggcgtgtgacagaggcggagacggggtggagcagggcggtccaagc
gaacctcctctagggtatgtggaacccagtgtagactctgatcaggaagtcagtgacgca
gcaagagcactgaagaagaagaagatttggtacttcaagcccttagagctgtctgacacg
gaggaaggcagagtgctgttggtaaatcttgacagacggatgtcgttaggattcttcaaa
tcttgcgttgaaacccacgtaggaacgacatcgctcaatttcaaggtgtatagagtctac
gctaacaatcaggagtttgagagtatccgcttgaatgagacgctgcaatcgtacagcgat
gacagtcggatagtcatcaaactaggcagagctcttaggaagggagagtaccgggtgaat
attcaccaactactagtcaactcaaatgagcccattagatatctgtttgattgggtgttt
gccaaaggtatgactgtgttgcagtccaagaaggagcttcttccagaactcaagaagaag
tgcagtatagacatccctctagacaggttacgtctgcgcaagaagtcttggaagaaccca
gccaccatcttcctcaatgatcgcatctatgaagaagatatccctatcttcacaaactgg
gaagtctttgtggagctcctagacagaccggagcaagtcgcatcgtcatcccagcttgca
ttgtacgtcaggcgatggcgcccttcgcagatgaagcttgaccccttcgaggaggtcatt
ctggacgataccaacgtctccgatctcaagacagcgttgtcggagctaagcgagatccct
ttggagaacattgagtttgccaaggggcgtggtacgttcccctgtgagatctcactcctt
gagatgaacactgacttggaatgggaacccagggtcactgcactcaatacctggcctctc
tacatcaccgatgatgggacggttatctactacagagataatagggaggagctaaaggag
ttacaagaagatgagaagaaggagatacagaagaaggaaaatgcaaggttatcaaagaca
ggtcagaaggtgacctactcccctcggaaggagagagcactcaagatctacaccgatagc
cctcctccatacagtgcaatcaactaa

DBGET integrated database retrieval system