KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577573Help
Entry
577573            CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase 40-like
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1300 aa AA seqDB search
MFGDLFGEEGETSSDVASQNSAQRSSKKDGLPQPPLLRGSTGLAGIANQGATCYLNSLLQ
TLLFTPEFRESLFALGQDELGNIADKEKPGSKVRVIPIHLQRLFARLLLLNQRSATTEEL
TDSFGWTNREELQQHDVQELSRILFCAIEDSLVGTSGENLISRLYRGSIVNQITCEECNR
ISERPEDFVDLTLAVGGYIGVVDTLRAYYVEEERMEGSNQYRCDRCKKLVNARKGAKLRS
LPPILTISLLRFSYDFVKLERFKETGHYTFPLELDMAPYCEQAKEEALYELYSVVLHSGS
THGGHYHAYIRDVDNLGTWSEPHKELIQLTPDSGSGKDDIIDMKSPQQCLTALLRKHGGS
EHVLSVENLCQVLNQETGVSWNKRFKRQYGTMTKFLRKYNDLFELNTAGSFVHLVDPMKG
KASSPDQSPSKSPREGARQDNTNAASEENHVNEEGGEAGQDQSNKERAIARATAKIPEPG
QCWYDFNDSSVEPIRENALYRQFQGRESAYMLLYRRKTMTRPTEAYNNAYHQMPAWLMAE
LETANQELEKQREVYDRSINSVELSLLLSSHCTWSRGALQLAPDREPVKITLDRRKTITH
LMGLIKEKVPEDNNECLHVAKSLPAGFHLFDSLTDSPDKTLQDCYVTDQSFIFLWDGKQV
DGNSILVGPTSEPILLILTYNAAPPSNTSTKPTPPPPSSPTELPHGFPKDTRISELRCMV
SDIVGIPKHRLKLSRVQSVPVVVSSEDDGRTLTQLDFSDGDKLMVESTGKDSPKSPRDFL
AAREADNQKNSVKLTIENRCVDPDDNGDWPVKQMDIPKDKTVFDLKQLIINTLGLYGNQR
PKEGCRLRISDDAMGLLAPLHENKSLTDSGVKIGKTIVIETGLPPTSNELTLNFSLMSGK
KSWDMMVDKSTSMSECLTKMLSIAGMEGTPYHLRKTNWCGEAADIITDMEQSLLQLHIQD
GELLMLEEGRIPPRGFLLLPVWLYPSPRRTSGAEEGGGGVSSWMPHVQFANILNSLSSAN
SPNHDIQQSLETPSNQHELLGEIEISQNATIGDLKSQVMTLPAMSQVVVPTVEFLRLRLL
EDGRQGRVLRDNNQSLKFARMNISQIAVQILPEEEHLRQTEFVLTFQKRIPDTRLYGTAE
DLVWDAGKSAAPSGLRQAIADRLLIPVERVALAKHFTKKAEWIVIPEDKKVSETGKGRGG
GKKKGKGQTHKAINLKHAPYLLRDGDVFGVVDLKDDPFRKDDFTTIEDDREKERKEEVEQ
EKRRNRRDRRNAVSLGGGESKEKSKKRQEIGLMIKVDNFR
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagacttatttggcgaagaaggcgaaacatcgtcggatgttgcaagtcaaaac
tcggcacagcgatccagcaagaaagatgggcttccacaacctcccttgttacggggaagt
accggcctagcgggtatcgcaaaccagggtgcgacgtgttacttgaattcacttctgcag
acattgctcttcacaccggaattcagagaatctctttttgctctgggacaagatgagctt
ggtaacattgctgataaggagaaaccagggagtaaggtacgagtcattcccatccacctt
cagcgattatttgctcgtcttctgttactaaaccagaggagtgcaaccactgaagaactg
acggatagctttggatggaccaacagagaggagttacagcagcatgatgttcaggaattg
agcaggatactgttctgtgccatcgaggatagtctggtgggtacatctggagagaacctc
atctcaaggctctataggggatctatcgttaaccagataacctgtgaagagtgcaataga
ataagtgagaggccggaggactttgttgacctaacgcttgctgtaggaggatacatagga
gtcgttgatactctcagggcctactatgtggaggaagaacggatggagggcagtaatcag
tataggtgtgacagatgtaagaaattagtcaacgcaagaaagggagccaagttacgttca
ttaccgccgattttaaccatttccttgctgagattcagctatgactttgtcaagctcgag
cgcttcaaggagacggggcattacacattcccgcttgagcttgacatggctccatactgt
gaacaggcgaaagaggaagccctatatgagttatattctgtagtgcttcacagcggtagc
acacatggaggtcactatcatgcgtacattagagacgtggacaatctaggaacctggtca
gaaccgcataaagagctgatccagctgacccctgactcaggaagtggaaaggatgacatc
attgatatgaaatctccccagcagtgtcttacagcgctcctgaggaagcacggtggatct
gaacatgtattgtctgttgaaaatctctgccaggttttaaaccaagagacaggcgtttca
tggaacaagcgcttcaagagacagtatggaacaatgaccaagtttctgaggaagtacaac
gacctatttgagctgaacacggcaggctccttcgtgcatctagtagaccctatgaaagga
aaggcatccagtccagaccaatctccctcaaagtcaccaagagagggcgccagacaggac
aacaccaacgcagcgtcggaagagaaccatgtgaatgaggaaggtggagaagcaggccag
gaccaaagtaataaggagagggccattgcaagagccactgcaaagatcccagaaccagga
cagtgttggtatgatttcaatgattcctcggtggagcccattagagagaacgccctctat
aggcagtttcagggaagggagagtgcctacatgctgctctatagacgaaagacaatgact
cgcccaaccgaagcatacaacaatgcataccatcagatgcctgcatggctaatggctgaa
ctggaaactgccaatcaggagctagaaaagcaaagggaagtatatgacagatcaatcaac
tctgttgagctgagcttgctcttatcatctcactgtacatggtcaagaggagccttgcag
cttgcaccggacagagaaccggtcaagattacacttgatagaaggaaaacaatcacacat
ctcatgggacttatcaaagaaaaagtgcctgaggataataatgagtgccttcatgttgcc
aaatcccttccagcagggtttcatttatttgattctctaacggacagcccagacaagacc
ctccaagattgttatgtaacagatcagagctttatcttcctatgggatggcaaacaggtt
gacggaaattccatcttagtcggcccaaccagcgagccaattctgctcattctaacctac
aacgctgcacccccttctaacacctccaccaagccaacgccaccaccccccagctccccc
acggagctcccacatggtttccctaaagacaccaggatatcagagctacggtgcatggtg
tcagatatcgtcggtatcccgaagcaccggttgaagcttagcagggtacagtcggtacca
gtggtggtgtcttcggaggatgatgggaggacactcacacagctagacttctcagatggt
gataagctgatggtggaatcaacaggcaaggacagtcccaaatctccacgtgacttttta
gcggcccgtgaagccgacaatcagaagaattctgtgaaattaacgattgagaacagatgt
gtagatccagacgacaatggtgactggcctgtcaaacagatggacatacccaaagacaag
accgtatttgacttgaagcagctgatcatcaacacccttggtctctatggtaaccagaga
cctaaggaaggatgtaggctgaggatcagtgatgatgcaatgggacttctagctccgtta
catgaaaacaagagcctgactgattctggcgtcaagataggcaagaccatcgtcatagaa
acgggactccctccaacatccaatgaactcaccctcaatttcagtctcatgtcgggcaaa
aagtcatgggatatgatggtggataaatctacttctatgtcagagtgcctgactaagatg
ttgagcatagcaggaatggagggcaccccctaccatctcaggaagaccaactggtgtgga
gaagcagctgatatcattactgacatggagcaaagtctactgcagcttcacatccaagat
ggagagcttctgatgctggaggagggtcggataccacccagagggttcctcctgctccct
gtctggctctatccttcgcctcggaggaccagtggggcggaagaaggaggaggtggggtg
tcgtcatggatgcctcacgtccagtttgcaaacatcctaaatagcctaagcagtgcaaac
agccccaaccatgatatccagcagtcactagagacaccgtccaatcagcatgagctccta
ggcgagattgagatatcccagaatgcaacaatcggtgacctcaagagtcaggtcatgacc
cttccagccatgagccaggtcgtcgtgccgacggtagagtttcttcgtcttcgtctatta
gaggatgggaggcagggcagagtattgagagataacaaccagagcctcaagtttgccaga
atgaatatctcacaaattgctgtccagatactaccagaagaagagcacctcagacaaaca
gagtttgttctgaccttccagaagaggatacctgatactagactctacggaaccgctgag
gatctcgtctgggatgctgggaagtctgctgcccccagtggtctacggcaagccattgct
gatcgcttgttgattccagtggagagagtggctcttgcgaagcactttacaaaaaaagct
gaatggatcgttatccctgaagacaagaaggtatcagagactgggaaagggagaggagga
gggaagaagaagggcaaaggtcaaactcacaaagcaatcaacttgaagcatgctccatac
cttctacgagatggagacgtgtttggtgtcgtggacttaaaagatgaccctttcaggaag
gatgacttcacaaccatcgaagatgatagagagaaggagcgaaaggaggaggtagagcag
gagaagagaagaaatagacgtgatagaaggaatgcagtttccctcggtggaggagaatct
aaggagaaatcaaagaagagacaagagattgggctgatgatcaaggttgataactttagg
tga

DBGET integrated database retrieval system