KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577640Help
Entry
577640            CDS       T01019                                 

Definition
histone-lysine N-methyltransferase SUV39H2-like
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:spu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 399 aa AA seqDB search
MAGCGEQVARGGEKSGSSGDEFDVEEIVDYQKDGNNIEWYLVKWVGYPSTDNTWEPKKNL
GNSRKLLKRFHKTYHKACITRTEILKQKRQLEKSLKQLAQKKRSNKWKESESKALTDVLK
SLVKKELKSWEQELNSKCQNEAPITIVNNVDLEGPPQDFVYIGDYIAGTGVDIPTDPPVG
CECDNCSSEAESRCCPQNGGVKFAYNKHKLVKAKPGTPIYECNKMCKCGEQCPNRVVQLG
RKHKLVIFRTENGRGWGVRTLVDIKKNSFVMEYVGEVITSEEAERRGKIYDANGRTYLFD
LDYNDDDCPFTVDAGHYGNISHFVNHSCEPNLVVYGVWVNCLDPRLPRIALFACSDIKAG
EELTFDYQMTGSVNEEGANELAQVECRCGSENCRGFLFE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtgtggtgaacaggttgctcgcggtggggaaaaatctggctcctctggagat
gaatttgacgtggaggagattgttgattaccaaaaagacggaaataatatagaatggtac
ctggtgaaatgggtgggatatccctctactgacaacacgtgggagcccaagaagaatctt
ggcaatagtagaaaactcctcaagaggttccataagacttatcataaagcatgcataact
cgcactgaaatactcaagcagaagagacaacttgagaagagtttgaaacagctcgctcaa
aagaagaggtccaacaagtggaaagaatccgagtccaaggcactgaccgatgtcctcaag
tccctggtcaagaaagagctcaaatcctgggagcaagagctcaactccaaatgtcagaat
gaagctcctatcacgatcgtcaacaacgtggacctggagggacctccccaggactttgtc
tacatcggcgactacatagcaggcacgggcgtcgacatcccaaccgaccccccggtcggc
tgcgagtgcgacaactgctcctctgaggccgaaagcaggtgctgtccccagaacggtggg
gtcaaatttgcctacaacaaacataaactcgtaaaagctaaaccaggaacgccaatctat
gagtgcaataagatgtgtaagtgtggagagcagtgtccgaacagggtggtccaattgggc
aggaaacacaagctggtcatcttcagaacggaaaacggcagaggctggggagtgaggacg
cttgtagatatcaagaagaactccttcgtcatggaatatgtaggagaggtcattacgagt
gaagaggcggagcgaagagggaagatctacgatgccaacggaaggacatatctctttgat
ctggactacaatgatgatgattgccccttcactgttgatgctggtcactatggcaacata
tctcattttgtcaaccattcttgcgagcctaatctagtggtgtatggtgtgtgggtgaat
tgccttgatcccagactgccccgcattgctctctttgcctgtagtgacatcaaggctggc
gaagaactcacctttgattatcagatgacaggttcagtgaacgaggaaggtgccaatgag
ttagctcaagtcgagtgcagatgtgggtcagaaaactgcaggggctttctgtttgaataa

DBGET integrated database retrieval system