KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577640Help
Entry
577640            CDS       T01019                                 

Definition
histone-lysine N-methyltransferase SUV39H2-like
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    577640
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     577640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 399 aa AA seqDB search
MAGCGEQVARGGEKSGSSGDEFDVEEIVDYQKDGNNIEWYLVKWVGYPSTDNTWEPKKNL
GNSRKLLKRFHKTYHKACITRTEILKQKRQLEKSLKQLAQKKRSNKWKESESKALTDVLK
SLVKKELKSWEQELNSKCQNEAPITIVNNVDLEGPPQDFVYIGDYIAGTGVDIPTDPPVG
CECDNCSSEAESRCCPQNGGVKFAYNKHKLVKAKPGTPIYECNKMCKCGEQCPNRVVQLG
RKHKLVIFRTENGRGWGVRTLVDIKKNSFVMEYVGEVITSEEAERRGKIYDANGRTYLFD
LDYNDDDCPFTVDAGHYGNISHFVNHSCEPNLVVYGVWVNCLDPRLPRIALFACSDIKAG
EELTFDYQMTGSVNEEGANELAQVECRCGSENCRGFLFE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtgtggtgaacaggttgctcgcggtggggaaaaatctggctcctctggagat
gaatttgacgtggaggagattgttgattaccaaaaagacggaaataatatagaatggtac
ctggtgaaatgggtgggatatccctctactgacaacacgtgggagcccaagaagaatctt
ggcaatagtagaaaactcctcaagaggttccataagacttatcataaagcatgcataact
cgcactgaaatactcaagcagaagagacaacttgagaagagtttgaaacagctcgctcaa
aagaagaggtccaacaagtggaaagaatccgagtccaaggcactgaccgatgtcctcaag
tccctggtcaagaaagagctcaaatcctgggagcaagagctcaactccaaatgtcagaat
gaagctcctatcacgatcgtcaacaacgtggacctggagggacctccccaggactttgtc
tacatcggcgactacatagcaggcacgggcgtcgacatcccaaccgaccccccggtcggc
tgcgagtgcgacaactgctcctctgaggccgaaagcaggtgctgtccccagaacggtggg
gtcaaatttgcctacaacaaacataaactcgtaaaagctaaaccaggaacgccaatctat
gagtgcaataagatgtgtaagtgtggagagcagtgtccgaacagggtggtccaattgggc
aggaaacacaagctggtcatcttcagaacggaaaacggcagaggctggggagtgaggacg
cttgtagatatcaagaagaactccttcgtcatggaatatgtaggagaggtcattacgagt
gaagaggcggagcgaagagggaagatctacgatgccaacggaaggacatatctctttgat
ctggactacaatgatgatgattgccccttcactgttgatgctggtcactatggcaacata
tctcattttgtcaaccattcttgcgagcctaatctagtggtgtatggtgtgtgggtgaat
tgccttgatcccagactgccccgcattgctctctttgcctgtagtgacatcaaggctggc
gaagaactcacctttgattatcagatgacaggttcagtgaacgaggaaggtgccaatgag
ttagctcaagtcgagtgcagatgtgggtcagaaaactgcaggggctttctgtttgaataa

DBGET integrated database retrieval system